DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pa1 and Pagr1a

DIOPT Version :10

Sequence 1:NP_572712.1 Gene:Pa1 / 32079 FlyBaseID:FBgn0287454 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_084516.1 Gene:Pagr1a / 67278 MGIID:1914528 Length:253 Species:Mus musculus


Alignment Length:117 Identity:33/117 - (28%)
Similarity:55/117 - (47%) Gaps:5/117 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DVEPAANTADKFSANAEELEGYYLMLEAGNIPELQWQFPGRRAPSPEAGS-GGNSKELEQATDAI 67
            :||..|| ...:.....|::..|.:|......|||.:...||.|:|||.| ...|.|..:|.:..
Mouse    94 EVELPAN-GQSWMPPPSEIQRLYELLATQGTLELQAEILPRRPPTPEAQSEEERSDEEPEAKEEE 157

  Fly    68 EQEPQKANDFDFSDDVAPTQMRVRSQTSTPKS---AKKKTANFAGVMETLKK 116
            |::|....:|||.|:....:..:..:..||.|   ::|:.|....|:..:|:
Mouse   158 EEKPHMPTEFDFDDEPMTPKDSLIDRRRTPGSSARSQKREARLDKVLSDMKR 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pa1NP_572712.1 PAXIP1_C 18..116 CDD:464674 28/101 (28%)
Pagr1aNP_084516.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..108 4/14 (29%)
PAXIP1_C 85..217 CDD:464674 33/117 (28%)
Sufficient for interaction with NCOA1. /evidence=ECO:0000250|UniProtKB:Q9BTK6 115..159 15/43 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 126..253 25/84 (30%)
Sufficient for interaction with ESR1. /evidence=ECO:0000250|UniProtKB:Q9BTK6 160..253 12/50 (24%)

Return to query results.
Submit another query.