DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dsh and DIXDC1

DIOPT Version :9

Sequence 1:NP_511118.2 Gene:dsh / 32078 FlyBaseID:FBgn0000499 Length:623 Species:Drosophila melanogaster
Sequence 2:NP_001033043.1 Gene:DIXDC1 / 85458 HGNCID:23695 Length:683 Species:Homo sapiens


Alignment Length:84 Identity:35/84 - (41%)
Similarity:55/84 - (65%) Gaps:1/84 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TKVIYHIDDETTPYLVKIPIPSAQVTLRDFKLVLNKQNNNYKYFFKSMDADFGVVKEEIADDSTI 75
            |||:|..|...||::|.||....:|||:|||..:::: .|::|.||::|.:||.|||||..|...
Human   601 TKVLYFTDRSLTPFMVNIPKRLEEVTLKDFKAAIDRE-GNHRYHFKALDPEFGTVKEEIFHDDDA 664

  Fly    76 LPCFNGRVVSWLVSADGTN 94
            :|.:.|::|:|:....|.|
Human   665 IPGWEGKIVAWVEEDHGEN 683

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dshNP_511118.2 DAX 8..91 CDD:197474 33/79 (42%)
Dishevelled <166..248 CDD:280528
PDZ_signaling 250..337 CDD:238492
DEP_dishevelled 395..478 CDD:239885
DIXDC1NP_001033043.1 CH_DIXDC1 22..128 CDD:409062
Actin-binding 127..300
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 207..235
Smc <281..>463 CDD:224117
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 482..509
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 556..594
DIX 600..677 CDD:395628 33/76 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150915
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.