DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dsh and Dixdc1

DIOPT Version :9

Sequence 1:NP_511118.2 Gene:dsh / 32078 FlyBaseID:FBgn0000499 Length:623 Species:Drosophila melanogaster
Sequence 2:XP_008764517.1 Gene:Dixdc1 / 363062 RGDID:1309902 Length:696 Species:Rattus norvegicus


Alignment Length:77 Identity:31/77 - (40%)
Similarity:53/77 - (68%) Gaps:1/77 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TKVIYHIDDETTPYLVKIPIPSAQVTLRDFKLVLNKQNNNYKYFFKSMDADFGVVKEEIADDSTI 75
            |||:|..|...||::|.||....:|||:|||..:::: .:::|.||::|.:||.||||:..|...
  Rat   615 TKVLYFTDRSLTPFMVNIPKRLGEVTLKDFKAAIDRE-GSHRYHFKALDPEFGTVKEEVFHDDDA 678

  Fly    76 LPCFNGRVVSWL 87
            :|.:.|::|:|:
  Rat   679 IPGWEGKIVAWV 690

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dshNP_511118.2 DAX 8..91 CDD:197474 31/77 (40%)
Dishevelled <166..248 CDD:280528
PDZ_signaling 250..337 CDD:238492
DEP_dishevelled 395..478 CDD:239885
Dixdc1XP_008764517.1 CH 22..138 CDD:237981
DUF342 <294..377 CDD:302792
Exonuc_VII_L <383..472 CDD:280721
DIX 614..689 CDD:279160 30/74 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344450
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.