DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dsh and Dixdc1

DIOPT Version :10

Sequence 1:NP_511118.2 Gene:dsh / 32078 FlyBaseID:FBgn0000499 Length:623 Species:Drosophila melanogaster
Sequence 2:XP_008764517.1 Gene:Dixdc1 / 363062 RGDID:1309902 Length:696 Species:Rattus norvegicus


Alignment Length:77 Identity:31/77 - (40%)
Similarity:53/77 - (68%) Gaps:1/77 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TKVIYHIDDETTPYLVKIPIPSAQVTLRDFKLVLNKQNNNYKYFFKSMDADFGVVKEEIADDSTI 75
            |||:|..|...||::|.||....:|||:|||..:::: .:::|.||::|.:||.||||:..|...
  Rat   615 TKVLYFTDRSLTPFMVNIPKRLGEVTLKDFKAAIDRE-GSHRYHFKALDPEFGTVKEEVFHDDDA 678

  Fly    76 LPCFNGRVVSWL 87
            :|.:.|::|:|:
  Rat   679 IPGWEGKIVAWV 690

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dshNP_511118.2 DAX 8..91 CDD:197474 31/77 (40%)
Dishevelled <174..248 CDD:460544
PDZ_Dishevelled-like 252..338 CDD:467201
DEP_dishevelled 395..478 CDD:239885
Dixdc1XP_008764517.1 CH_DIXDC1 22..140 CDD:409062
Smc <293..>487 CDD:440809
DIX 615..690 CDD:459936 30/75 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.