DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dsh and dixdc1a

DIOPT Version :10

Sequence 1:NP_511118.2 Gene:dsh / 32078 FlyBaseID:FBgn0000499 Length:623 Species:Drosophila melanogaster
Sequence 2:NP_878304.1 Gene:dixdc1a / 360137 ZFINID:ZDB-GENE-030721-2 Length:443 Species:Danio rerio


Alignment Length:82 Identity:34/82 - (41%)
Similarity:55/82 - (67%) Gaps:1/82 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TKVIYHIDDETTPYLVKIPIPSAQVTLRDFKLVLNKQNNNYKYFFKSMDADFGVVKEEIADDSTI 75
            |||:|:.|...||:||.||.....|||:|||..::: :.:::|.|||:|.:||.||||:..|..:
Zfish   360 TKVLYYTDRSLTPFLVNIPKRLGDVTLQDFKAAVDR-HGSFRYHFKSLDPEFGTVKEEVFQDDAV 423

  Fly    76 LPCFNGRVVSWLVSADG 92
            :|.:.|::|:|:....|
Zfish   424 IPGWEGKIVAWVEEDHG 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dshNP_511118.2 DAX 8..91 CDD:197474 33/79 (42%)
Dishevelled <174..248 CDD:460544
PDZ_Dishevelled-like 252..338 CDD:467201
DEP_dishevelled 395..478 CDD:239885
dixdc1aNP_878304.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 46..68
Smc <71..>245 CDD:440809
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 309..349
DIX 359..435 CDD:459936 32/75 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.