DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NdufV3 and Ndufv3

DIOPT Version :10

Sequence 1:NP_572710.1 Gene:NdufV3 / 32076 FlyBaseID:FBgn0030292 Length:109 Species:Drosophila melanogaster
Sequence 2:NP_084363.2 Gene:Ndufv3 / 78330 MGIID:1890894 Length:468 Species:Mus musculus


Alignment Length:87 Identity:20/87 - (22%)
Similarity:38/87 - (43%) Gaps:15/87 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VSGGGRPSASGSPAGAGSSPSGGASSPSVVGLTSNCVKPSSGPVG---PGASATGGYKVPEYYSF 85
            |....||...|....|..:|            .::.|.|...|..   |..:.|..||..:::.:
Mouse   387 VEESARPHLEGRFQVAVEAP------------PTDAVLPQEAPADTQEPEPTDTTTYKNLQHHDY 439

  Fly    86 NRFSYAEAEVEMAKYRCPQPSA 107
            |.:::.:..::::|:|.||||:
Mouse   440 NTYTFLDLNLDLSKFRLPQPSS 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NdufV3NP_572710.1 NDUFV3 77..107 CDD:464921 8/29 (28%)
Ndufv3NP_084363.2 PHA03247 <172..424 CDD:223021 9/48 (19%)
NDUFV3 427..461 CDD:464921 9/33 (27%)

Return to query results.
Submit another query.