DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1738 and zgc:194224

DIOPT Version :9

Sequence 1:NP_572709.1 Gene:CG1738 / 32075 FlyBaseID:FBgn0030291 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001124266.1 Gene:zgc:194224 / 799070 ZFINID:ZDB-GENE-081022-79 Length:239 Species:Danio rerio


Alignment Length:189 Identity:54/189 - (28%)
Similarity:76/189 - (40%) Gaps:42/189 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NVSADFKPVPTRAALALQKKQENTEFQAHVFHESHFQSKSGTKKQDDGVQKSHKT--KEGGMELN 64
            |...|..|..|:     |.|.|...|...:......||....:|..|..:|...|  |:|   |:
Zfish    62 NADTDSNPAGTK-----QSKVEVVTFVDPLKKNKLSQSVEPKQKVPDVKEKMMMTMKKKG---LD 118

  Fly    65 PEFDIKKARHEVLNFAI-----KNQRVIKNKSKMEMFQLIKLGAKPLKKASKNYK----ELKDER 120
            .:..|:|||.||..|.:     :.|||.:.:      :.|.|||:|.||...|||    :||:.:
Zfish   119 EKLTIEKARFEVHRFGLSGYQKQQQRVFEEE------RAIMLGARPPKKQYVNYKVYQQQLKERK 177

  Fly   121 QRLKNIREERKKFHQLGKNQTGAASVKCRTKSQKERNDKRRAPVSHIDQHYGKAQPKFK 179
            .:.|   ||.|...|           |.|.|..|.|.:|.:...|   :..|....:||
Zfish   178 MKEK---EEAKPELQ-----------KKRRKEGKPRTEKSKPSSS---RELGGQVGRFK 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1738NP_572709.1 DUF4602 39..154 CDD:292019 38/125 (30%)
zgc:194224NP_001124266.1 DUF4602 84..>172 CDD:292019 29/96 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576553
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C8F9
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007846
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR28366
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.890

Return to query results.
Submit another query.