DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1738 and C1orf131

DIOPT Version :9

Sequence 1:NP_572709.1 Gene:CG1738 / 32075 FlyBaseID:FBgn0030291 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_689592.2 Gene:C1orf131 / 128061 HGNCID:25332 Length:293 Species:Homo sapiens


Alignment Length:196 Identity:51/196 - (26%)
Similarity:84/196 - (42%) Gaps:46/196 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KPVPTRAALALQKKQENTEFQAHVFHESHFQSKSGT------------------KKQDDGVQKSH 54
            :|.|...:|...:::..:.|...:..|.|. :.|||                  .::...|.:.|
Human    71 EPSPLPGSLIRGQRKSASSFFKELREERHC-APSGTPTGPEILAAAVPPSSLKNNREQVEVVEFH 134

  Fly    55 KTKEGGM---------ELNP----------EFDIKKARHEVLNFAIKNQRVIKNKSK-MEMFQLI 99
            ..|:..:         :.||          ||:::|||.||..|.|....  |.|.: :|..:.|
Human   135 SNKKRKLTPDHNKNTKQANPSVLERDVDTQEFNLEKARLEVHRFGITGYG--KGKERILEQERAI 197

  Fly   100 KLGAKPLKKASKNYKELKDERQRLKNIREERKKFHQLGKNQTGAASVKCRTKSQKERNDKRRAPV 164
            .|||||.||:..|||.|:::.:..|..:||.|:..|    :|.....|.| |.|::|..|:::..
Human   198 MLGAKPPKKSYVNYKVLQEQIKEKKAAKEEEKRLAQ----ETDIFKKKKR-KGQEDRKSKKKSAP 257

  Fly   165 S 165
            |
Human   258 S 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1738NP_572709.1 DUF4602 39..154 CDD:292019 41/152 (27%)
C1orf131NP_689592.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..82 3/10 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 94..119 5/25 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 134..160 4/25 (16%)
DUF4602 135..252 CDD:317742 38/123 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 222..266 13/42 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143650
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C8F9
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007846
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR28366
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.890

Return to query results.
Submit another query.