Sequence 1: | NP_572709.1 | Gene: | CG1738 / 32075 | FlyBaseID: | FBgn0030291 | Length: | 182 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_689592.2 | Gene: | C1orf131 / 128061 | HGNCID: | 25332 | Length: | 293 | Species: | Homo sapiens |
Alignment Length: | 196 | Identity: | 51/196 - (26%) |
---|---|---|---|
Similarity: | 84/196 - (42%) | Gaps: | 46/196 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 KPVPTRAALALQKKQENTEFQAHVFHESHFQSKSGT------------------KKQDDGVQKSH 54
Fly 55 KTKEGGM---------ELNP----------EFDIKKARHEVLNFAIKNQRVIKNKSK-MEMFQLI 99
Fly 100 KLGAKPLKKASKNYKELKDERQRLKNIREERKKFHQLGKNQTGAASVKCRTKSQKERNDKRRAPV 164
Fly 165 S 165 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG1738 | NP_572709.1 | DUF4602 | 39..154 | CDD:292019 | 41/152 (27%) |
C1orf131 | NP_689592.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..28 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 40..82 | 3/10 (30%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 94..119 | 5/25 (20%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 134..160 | 4/25 (16%) | |||
DUF4602 | 135..252 | CDD:317742 | 38/123 (31%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 222..266 | 13/42 (31%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165143650 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_2C8F9 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0007846 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | LDO | PTHR28366 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.890 |