DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34348 and GPT2

DIOPT Version :9

Sequence 1:NP_001096954.1 Gene:CG34348 / 32072 FlyBaseID:FBgn0085377 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_012993.3 Gene:GPT2 / 853941 SGDID:S000001775 Length:743 Species:Saccharomyces cerevisiae


Alignment Length:330 Identity:60/330 - (18%)
Similarity:102/330 - (30%) Gaps:133/330 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SSYIDLDYSL--WLYRFLTPLIVTFLLPLVFVALIYISFLVLFIYKLHRQVIMRAVQGDRNFWRV 78
            :||....|::  |||.             |.|.|..|.|.:.|     |::.:|           
Yeast    26 NSYNGFVYNIHTWLYD-------------VSVFLFNILFTIFF-----REIKVR----------- 61

  Fly    79 GRKIVAAIWDAHARIYHGYEVIGLENVPQEG-PALIVYYHGAIPIDMYYLNSRMLLQRERLIYTI 142
                                  |..|||:.| |.::|    ..|....:::..:::.:.||:.|.
Yeast    62 ----------------------GAYNVPEVGVPTILV----CAPHANQFIDPALVMSQTRLLKTS 100

  Fly   143 GDRFLFKLPGWGTISEAF---------HVSPGTVQSCVSILRDGNLLAISPG-GVYEAQFGDHYY 197
            ..:...::|.:.|...:|         |...|..   |..::| ||..:... .:|.....:|..
Yeast   101 AGKSRSRMPCFVTAESSFKKRFISFFGHAMGGIP---VPRIQD-NLKPVDENLEIYAPDLKNHPE 161

  Fly   198 ELLWRNR------VGFAKVAIEAKAPI-IPCFTQN-------------LREGFR----------- 231
            .:..|::      |.|.| ...||:.: :|.:..|             |...||           
Yeast   162 IIKGRSKNPQTTPVNFTK-RFSAKSLLGLPDYLSNAQIKEIPDDETIILSSPFRTSKSKVVELLT 225

  Fly   232 ------------QVGIFRTFFMRLYNKVRIPVYPIYGGFPVKFRTYLGKPIPYDENLTPQDLQIK 284
                        ....|::.|..|:.|..:.::|..|.              :|.   |..|.||
Yeast   226 NGTNFKYAEKIDNTETFQSVFDHLHTKGCVGIFPEGGS--------------HDR---PSLLPIK 273

  Fly   285 VATAI 289
            ...||
Yeast   274 AGVAI 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34348NP_001096954.1 PlsC 47..271 CDD:223282 45/277 (16%)
LPLAT_MGAT-like 90..298 CDD:153249 46/254 (18%)
GPT2NP_012993.3 LPLAT 45..348 CDD:418432 52/298 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.