DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34348 and CST26

DIOPT Version :9

Sequence 1:NP_001096954.1 Gene:CG34348 / 32072 FlyBaseID:FBgn0085377 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_009598.1 Gene:CST26 / 852330 SGDID:S000000246 Length:397 Species:Saccharomyces cerevisiae


Alignment Length:83 Identity:19/83 - (22%)
Similarity:35/83 - (42%) Gaps:13/83 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 HARIYHGYEVIGLENVPQEGPALIVYYHGAIPIDMYYLNSRMLLQRERLIYTIG---DRFLFKLP 151
            |.:|.|     .:..|...|.:|::::.|.:.:....|..:.|..|..:...||   .:.||.: 
Yeast     3 HQKIAH-----KVRKVVVPGISLLIFFQGCLILLFLQLTYKTLYCRNDIRKQIGLNKTKRLFIV- 61

  Fly   152 GWGTISEAFH-VSPGTVQ 168
               .:|...| |:|..|:
Yeast    62 ---LVSSILHVVAPSAVR 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34348NP_001096954.1 PlsC 47..271 CDD:223282 19/83 (23%)
LPLAT_MGAT-like 90..298 CDD:153249 19/83 (23%)
CST26NP_009598.1 LPLAT_LCLAT1-like 103..314 CDD:153252
Acyltransf_C 300..372 CDD:406475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.