DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34348 and SCT1

DIOPT Version :9

Sequence 1:NP_001096954.1 Gene:CG34348 / 32072 FlyBaseID:FBgn0085377 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_009542.1 Gene:SCT1 / 852271 SGDID:S000000107 Length:759 Species:Saccharomyces cerevisiae


Alignment Length:101 Identity:26/101 - (25%)
Similarity:50/101 - (49%) Gaps:19/101 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 RKIVAAI--WDAHARIYHGY--EVIGLEN--VPQEGPALIVYYHGAIPIDMYYLNSRMLL----- 133
            :||:.:|  |..: .|:|.:  |:.|..:  |||:||.:.|    |.|....:::..:|:     
Yeast    47 KKILYSIATWLLY-NIFHCFFREIRGRGSFKVPQQGPVIFV----AAPHANQFVDPVILMGEVKK 106

  Fly   134 -QRERLIYTIGDRFLFKLPGWGTISEAFHVSPGTVQ 168
             ...|:.:.|.:..| |.|..|.:: :|.::.|.|:
Yeast   107 SVNRRVSFLIAESSL-KQPPIGFLA-SFFMAIGVVR 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34348NP_001096954.1 PlsC 47..271 CDD:223282 26/101 (26%)
LPLAT_MGAT-like 90..298 CDD:153249 22/89 (25%)
SCT1NP_009542.1 LPLAT_AAK14816-like 56..343 CDD:153254 23/92 (25%)
MASE4 <441..548 CDD:319176
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.