DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34348 and GPAT3

DIOPT Version :9

Sequence 1:NP_001096954.1 Gene:CG34348 / 32072 FlyBaseID:FBgn0085377 Length:323 Species:Drosophila melanogaster
Sequence 2:XP_016864269.1 Gene:GPAT3 / 84803 HGNCID:28157 Length:526 Species:Homo sapiens


Alignment Length:351 Identity:70/351 - (19%)
Similarity:116/351 - (33%) Gaps:136/351 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 YIDLDYSL-WLYRFLTPLIVTFLLPL-VFVALIYISFLVL-------------------FIYKLH 61
            ||.|..:: |:...:....|  |||| |.:|.|.||.||:                   .::...
Human   228 YISLRLTMVWVLGVIVRYCV--LLPLRVTLAFIGISLLVIGTTLVGQLPDSSLKNWLSELVHLTC 290

  Fly    62 RQVIMRAVQGDRNFWRVGRKIVAAIWDAHARIYHGYEVIGLENVPQEGPALIVYYHGAIPIDMYY 126
            .::.:||:.|..::              |.:.|.          ||:| .:.|..|.: |||:..
Human   291 CRICVRALSGTIHY--------------HNKQYR----------PQKG-GICVANHTS-PIDVLI 329

  Fly   127 LNS--------------RMLLQR-----------------------ERLIYTIGDRFLFKLPGWG 154
            |.:              ..::||                       :||...|.|:  .|||   
Human   330 LTTDGCYAMVGQVHGGLMGIIQRAMVKACPHVWFERSEMKDRHLVTKRLKEHIADK--KKLP--- 389

  Fly   155 TISEAFHVSP-GTV--QSCVSILRDGNLL---AISPGGV-YEAQFGDHYYELLWRNRVGF----- 207
                 ..:.| ||.  .:.|.:.:.|:..   .|.|..: |..||||.::.....|.|.:     
Human   390 -----ILIFPEGTCINNTSVMMFKKGSFEIGGTIHPVAIKYNPQFGDAFWNSSKYNMVSYLLRMM 449

  Fly   208 AKVAIEAKAPIIPCFTQNLREGFRQVGIFRTFFMRLYNKVRIPVYPIYGGFPVKFRTYLGKPIPY 272
            ...||......:|..|:  .||...|        :..|:|:..: .|.||.         ..:|:
Human   450 TSWAIVCDVWYMPPMTR--EEGEDAV--------QFANRVKSAI-AIQGGL---------TELPW 494

  Fly   273 DENLTPQDLQIKVATAIEDLINQHQR 298
            |..|.        ...::|:..:.|:
Human   495 DGGLK--------RAKVKDIFKEEQQ 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34348NP_001096954.1 PlsC 47..271 CDD:223282 54/291 (19%)
LPLAT_MGAT-like 90..298 CDD:153249 50/256 (20%)
GPAT3XP_016864269.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.