DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34348 and PES1

DIOPT Version :9

Sequence 1:NP_001096954.1 Gene:CG34348 / 32072 FlyBaseID:FBgn0085377 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_564662.1 Gene:PES1 / 841899 AraportID:AT1G54570 Length:704 Species:Arabidopsis thaliana


Alignment Length:376 Identity:76/376 - (20%)
Similarity:133/376 - (35%) Gaps:108/376 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KTLHSLLSS-----YIDLDYSL---------------------WLYRFLTPLIVTFLLP----LV 43
            |.||.||.:     :.|..::|                     |.|    .|:..||.|    |.
plant   347 KRLHGLLKNCSVRCFKDNGHTLLLEDSISLLTVIKGTGKYRRSWRY----DLVSDFLPPSKGELA 407

  Fly    44 FVALIYISFLVLFIYKLHRQVIMRAVQGDRNFWRVGRKIVAAIWDAHARIYHGYEVIGLENVPQE 108
            :.....:.||                   ||  .||....:.:.|       |..|.||..||.:
plant   408 YALDEVLGFL-------------------RN--AVGSVFFSTMED-------GKIVKGLAGVPDK 444

  Fly   109 GPALIVYYHGAIPIDMYYLNSRMLLQRERLIYTIGDRFLF------KLPGWGTISEAFHVSPGTV 167
            ||.|:|.||..:.:::..::...:.::..|...:....|:      |...:|...:.|...|.|.
plant   445 GPVLLVGYHMLMGLELGPMSEAFIKEKNILFRGMAHPVLYSDNDPAKAFDYGDWIKVFGAYPVTA 509

  Fly   168 QSCVSILRDGNLLAISPGGVYEAQFG-DHYYELLWRNRVGFAKVAIEAKAPIIPCFT---QNLRE 228
            .:...:|...:.:.:.|||..||... ...|:|:|..:..|.::|....|.|:|..|   .::.|
plant   510 TNLFKLLDSKSHVLLFPGGAREALHNRGEQYKLIWPEQQEFVRMAARFGATIVPFGTVGEDDIAE 574

  Fly   229 ------GFRQVGIF-----------RTFFMRLYNKVRIPVYPIY-----GGFPVKFRTYLGKPI- 270
                  ...::.|.           :.|.:|..::..:...|:|     ...|.:|....|||| 
plant   575 LVLDYNDLMKIPILNDYITEVTRDTKQFKLREESEGEVANQPLYLPGLIPKVPGRFYYLFGKPIE 639

  Fly   271 ----------PYDENLTPQDLQIKVATAIEDLINQHQRLPGSILLALLDRL 311
                      ..:.|....:::.:|..:|..|:.:.:..|   ..::||||
plant   640 TKGRPELVKDKEEANQVYLEVKAEVENSIAYLLKKREEDP---YRSVLDRL 687

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34348NP_001096954.1 PlsC 47..271 CDD:223282 53/266 (20%)
LPLAT_MGAT-like 90..298 CDD:153249 50/250 (20%)
PES1NP_564662.1 MhpC 123..372 CDD:223669 7/24 (29%)
LPLAT_MGAT-like 432..669 CDD:153249 48/236 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.