DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34348 and AT5G41120

DIOPT Version :9

Sequence 1:NP_001096954.1 Gene:CG34348 / 32072 FlyBaseID:FBgn0085377 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001331275.1 Gene:AT5G41120 / 834114 AraportID:AT5G41120 Length:689 Species:Arabidopsis thaliana


Alignment Length:337 Identity:73/337 - (21%)
Similarity:127/337 - (37%) Gaps:88/337 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 ALIYISFLVL---FIYKLHRQVIMRAVQGDRNFWRVGRKIVAAIWDA--HARIYHGYEVIGLENV 105
            :|.|||..:|   |.:|.:.:               .::::.|:...  .:.:.:|..|..|..:
plant   374 SLDYISDYILPTPFEFKEYEE---------------SQRLLTAVTSPVFLSTLKNGAVVRSLAGI 423

  Fly   106 PQEGPALIVYYHGAIPIDMYYLNSRMLLQRERLIYTIGDRFLF------KLPGWGTISEAFHV-- 162
            |.|||.|.|..|..:.::::.:....|.:|..|:..:....:|      |||.. .:.:.|.:  
plant   424 PSEGPVLYVGNHMLLGMELHAIALHFLKERNILLRGLAHPLMFTKKTGSKLPDM-QLYDLFRIIG 487

  Fly   163 -SPGTVQSCVSILRDGNLLAISPGGVYEA--QFGDHYYELLWRNRVGFAKVAIEAKAPIIP---- 220
             .|.:..:...:||....:|:.||||.||  :.|:. |:|.|.....|.::|.:..|.|||    
plant   488 AVPVSGMNFYKLLRSKAHVALYPGGVREALHRKGEE-YKLFWPEHSEFVRIASKFGAKIIPFGVV 551

  Fly   221 -----C-------------FTQNLREGFRQVGIFRTFFMRLYN-------KVRIPVYPIYGGFPV 260
                 |             |.:||.|...|..:      .|.|       |..:.:..|....|.
plant   552 GEDDLCEMVLDYDDQMKIPFLKNLIEEITQDSV------NLRNDEEGELGKQDLHLPGIVPKIPG 610

  Fly   261 KFRTYLGKPI-------PYDENLTPQDLQIKVATAIEDLIN----------QHQRLPGSILL--- 305
            :|..|.||||       ..:......::.::|.:.:|..:|          ....||.|:..   
plant   611 RFYAYFGKPIDTEGREKELNNKEKAHEVYLQVKSEVERCMNYLKIKRETDPYRNILPRSLYYLTH 675

  Fly   306 ALLDRLPTFRRR 317
            ....::|||..|
plant   676 GFSSQIPTFDLR 687

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34348NP_001096954.1 PlsC 47..271 CDD:223282 63/275 (23%)
LPLAT_MGAT-like 90..298 CDD:153249 58/264 (22%)
AT5G41120NP_001331275.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.