DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34348 and DGAT2

DIOPT Version :9

Sequence 1:NP_001096954.1 Gene:CG34348 / 32072 FlyBaseID:FBgn0085377 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_566952.1 Gene:DGAT2 / 824315 AraportID:AT3G51520 Length:314 Species:Arabidopsis thaliana


Alignment Length:333 Identity:79/333 - (23%)
Similarity:130/333 - (39%) Gaps:86/333 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 HSLLSSYIDLDYSLWL--YRFLTPLI---VTFLLPLVFVALIYISFLVLFIYKLHRQVIMRAVQG 71
            ||:::      .::||  ..|...|:   :.||.|.:.:.::.:..|.:||...||.        
plant    17 HSIIA------MAIWLGAIHFNVALVLCSLIFLPPSLSLMVLGLLSLFIFIPIDHRS-------- 67

  Fly    72 DRNFWRVGRKIVAAIWDAHARIY-------HGYEVIGLENVPQEGPALIVYY--HGAIPIDMYYL 127
                 :.|||:...|. .||..|       ..||..      |...|.:..|  |..:||.:..|
plant    68 -----KYGRKLARYIC-KHACNYFPVSLYVEDYEAF------QPNRAYVFGYEPHSVLPIGVVAL 120

  Fly   128 ----------NSRMLLQRERLIYTIGDRFLFKLPGWGTISEAFHVSPGTVQSCVSILRDGNLLAI 182
                      |.::|.. ..:.||   .||..:..|..::.|      :.::..|:|..|....:
plant   121 CDLTGFMPIPNIKVLAS-SAIFYT---PFLRHIWTWLGLTAA------SRKNFTSLLDSGYSCVL 175

  Fly   183 SPGGVYEAQFGDHYYE--LLWRNRVGFAKVAIEAKAPIIPCFTQNLREGFRQVGIFR------TF 239
            .||||.|.....|..|  .|.|.| ||.::|:|..:|::|.|.      |.|..:::      ..
plant   176 VPGGVQETFHMQHDAENVFLSRRR-GFVRIAMEQGSPLVPVFC------FGQARVYKWWKPDCDL 233

  Fly   240 FMRLYNKVRIPVYPIYG--GFPVKFR----TYLGKPIPYDENLTPQDLQI-----KVATAIEDLI 293
            :::|...:|......:|  |.|:..|    ..:||||...:.|.|.|.:|     :...|:.||.
plant   234 YLKLSRAIRFTPICFWGVFGSPLPCRQPMHVVVGKPIEVTKTLKPTDEEIAKFHGQYVEALRDLF 298

  Fly   294 NQHQRLPG 301
            .:|:...|
plant   299 ERHKSRVG 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34348NP_001096954.1 PlsC 47..271 CDD:223282 60/256 (23%)
LPLAT_MGAT-like 90..298 CDD:153249 60/245 (24%)
DGAT2NP_566952.1 PLN02783 1..314 CDD:178380 79/333 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.