DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34348 and PES2

DIOPT Version :9

Sequence 1:NP_001096954.1 Gene:CG34348 / 32072 FlyBaseID:FBgn0085377 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_566801.1 Gene:PES2 / 822299 AraportID:AT3G26840 Length:701 Species:Arabidopsis thaliana


Alignment Length:249 Identity:59/249 - (23%)
Similarity:97/249 - (38%) Gaps:62/249 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 GYEVIGLENVPQEGPALIVYYHGAIPIDMYYLNSRMLLQRERLIYTIGDRFLFKLPGWGTIS--- 157
            |..|..||.:|.|||.|.|.||..:..::..:..:::.:|...:..:....|||......:.   
plant   430 GTVVRSLEGLPSEGPVLYVGYHMILGFELAPMVIQLMTERNIHLRGLAHPMLFKNLQDSLVDTKM 494

  Fly   158 -EAFHVSPGTVQSCVSI---LRDGNLLAISPGGVYEA--QFGDHYYELLWRNRVGFAKVAIEAKA 216
             :.:.:..|...|..:|   ||:...:.:.||||.||  :.|:. |:|.|..|..|.:||.:..|
plant   495 FDKYKIMGGVPVSHFNIYKLLREKAHVLLYPGGVREALHRKGEE-YKLFWPERSEFVRVASKFGA 558

  Fly   217 PIIP---------C------------------------FTQNLREGFR-QVGIFRTFFMRLYNKV 247
            .|:|         |                        ...|:|||.. ::|....:|..|..|:
plant   559 KIVPFGVVGEDDICEIVLDSNDQRNIPILKDLMEKATKDAGNIREGDESELGNQECYFPGLVPKI 623

  Fly   248 RIPVYPIYGGFPVKFRTYLGKPI-------PYDENLTPQDLQIKVATAIEDLIN 294
                       |.:|..|.||||       ...:....|:|.::|.:.:|..|:
plant   624 -----------PGRFYYYFGKPIETAGKEKELKDKEKAQELYLQVKSEVEQCID 666

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34348NP_001096954.1 PlsC 47..271 CDD:223282 54/224 (24%)
LPLAT_MGAT-like 90..298 CDD:153249 59/249 (24%)
PES2NP_566801.1 Abhydrolase_1 121..371 CDD:278959
Abhydrolase <181..>216 CDD:304388
LPLAT_MGAT-like 430..666 CDD:153249 58/247 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.