Sequence 1: | NP_001096954.1 | Gene: | CG34348 / 32072 | FlyBaseID: | FBgn0085377 | Length: | 323 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_566801.1 | Gene: | PES2 / 822299 | AraportID: | AT3G26840 | Length: | 701 | Species: | Arabidopsis thaliana |
Alignment Length: | 249 | Identity: | 59/249 - (23%) |
---|---|---|---|
Similarity: | 97/249 - (38%) | Gaps: | 62/249 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 96 GYEVIGLENVPQEGPALIVYYHGAIPIDMYYLNSRMLLQRERLIYTIGDRFLFKLPGWGTIS--- 157
Fly 158 -EAFHVSPGTVQSCVSI---LRDGNLLAISPGGVYEA--QFGDHYYELLWRNRVGFAKVAIEAKA 216
Fly 217 PIIP---------C------------------------FTQNLREGFR-QVGIFRTFFMRLYNKV 247
Fly 248 RIPVYPIYGGFPVKFRTYLGKPI-------PYDENLTPQDLQIKVATAIEDLIN 294 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG34348 | NP_001096954.1 | PlsC | 47..271 | CDD:223282 | 54/224 (24%) |
LPLAT_MGAT-like | 90..298 | CDD:153249 | 59/249 (24%) | ||
PES2 | NP_566801.1 | Abhydrolase_1 | 121..371 | CDD:278959 | |
Abhydrolase | <181..>216 | CDD:304388 | |||
LPLAT_MGAT-like | 430..666 | CDD:153249 | 58/247 (23%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0204 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |