DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34348 and agpat5

DIOPT Version :9

Sequence 1:NP_001096954.1 Gene:CG34348 / 32072 FlyBaseID:FBgn0085377 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001070213.2 Gene:agpat5 / 767778 ZFINID:ZDB-GENE-060929-914 Length:365 Species:Danio rerio


Alignment Length:151 Identity:33/151 - (21%)
Similarity:56/151 - (37%) Gaps:38/151 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 WRVGRKIVAAIWDAHARIYH-----GYEV------IGLENVPQEGPALIVYYHGAIPIDMYYLNS 129
            |.|.|.:.|.:   .||:||     .|.|      ...||  ..|..:::|  |.||        
Zfish    32 WSVWRLLSAIL---PARLYHTVDDRAYSVYQSMVLFFFEN--YTGVEIVIY--GEIP-------- 81

  Fly   130 RMLLQRERLIYTIGDRFLFKLPGWGTISEAFHVSPGTVQSCVSILRDGNLLAISPGGVYEAQFGD 194
               .::|.::|....:   ....| .|::...:....:.....:|:|| |..:...|.|.:|.|.
Zfish    82 ---KKKENVVYLSNHQ---STADW-IIADMLAIRQNAIGHVRYVLKDG-LKWLPLYGWYFSQHGG 138

  Fly   195 HYYELLWRNRVGFAKVAIEAK 215
            .|.    :....|.:.|::.|
Zfish   139 VYV----KRSANFDEKAMKKK 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34348NP_001096954.1 PlsC 47..271 CDD:223282 33/151 (22%)
LPLAT_MGAT-like 90..298 CDD:153249 29/137 (21%)
agpat5NP_001070213.2 LPLAT_LCLAT1-like 63..263 CDD:153252 23/117 (20%)
Acyltransf_C 258..327 CDD:292694
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.