DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34348 and Agpat2

DIOPT Version :9

Sequence 1:NP_001096954.1 Gene:CG34348 / 32072 FlyBaseID:FBgn0085377 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_080488.1 Gene:Agpat2 / 67512 MGIID:1914762 Length:278 Species:Mus musculus


Alignment Length:222 Identity:50/222 - (22%)
Similarity:87/222 - (39%) Gaps:67/222 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PLVFVALIYISFLVLFIYKLHRQVIMRAVQGDRNFWRVGRKIVAAI-WDAHARIY----HG---- 96
            |.:..||:    |:|.:.:|.|..        |.:.:||...|..: :.|.|.|.    ||    
Mouse     5 PWLTAALL----LLLLLVQLSRTA--------RFYAKVGLYCVLCLSFSAAASIVCLLRHGGRTV 57

  Fly    97 --------------------YEVIGLENVPQEGPALIVYYHGAIPIDMY----YLNSRML-LQRE 136
                                :||.|.:.:..:||.:|:..|.:| :||.    .|..|.: :.:.
Mouse    58 DNMSIISWFVRSFKYVYGLRFEVSGQKKLEVDGPCVIISNHQSI-LDMMGLMEILPKRCVQIAKR 121

  Fly   137 RLIYTIGDRFLFKLPGWGTISEAFHVSPGTVQSCVSILRD-GNLLA-------ISPGGVYEAQFG 193
            .|::|.....:..|.|      .:.::....::.:|::.| |:|:.       |.|.|..... |
Mouse   122 ELMFTGPVGLIMYLGG------VYFINRQQARTAMSVMADLGDLMVKENLKVWIYPEGTRNDN-G 179

  Fly   194 DHYYELLWRNRVGFAKVAIEAKAPIIP 220
            |     |...:.|...:||:|:.||||
Mouse   180 D-----LLPFKKGAFYLAIQAQVPIIP 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34348NP_001096954.1 PlsC 47..271 CDD:223282 48/216 (22%)
LPLAT_MGAT-like 90..298 CDD:153249 38/172 (22%)
Agpat2NP_080488.1 PlsC 30..259 CDD:223282 42/185 (23%)
LPLAT_AGPAT-like 67..240 CDD:153251 34/148 (23%)
HXXXXD motif. /evidence=ECO:0000250|UniProtKB:Q9D517 98..103 2/5 (40%)
EGTR motif. /evidence=ECO:0000250|UniProtKB:O15120 172..175 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.