DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34348 and AGPAT4

DIOPT Version :9

Sequence 1:NP_001096954.1 Gene:CG34348 / 32072 FlyBaseID:FBgn0085377 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_064518.1 Gene:AGPAT4 / 56895 HGNCID:20885 Length:378 Species:Homo sapiens


Alignment Length:171 Identity:33/171 - (19%)
Similarity:49/171 - (28%) Gaps:76/171 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 RKIVAAIWDA---------------------HARIYHGYEVIGLENVPQEGPALIVYYHGAIPID 123
            |.:|:|::|.                     ||.:|  ...|.||::|::......:.|      
Human   219 RNVVSAVYDCTLNFRNNENPTLLGVLNGKKYHADLY--VRRIPLEDIPEDDDECSAWLH------ 275

  Fly   124 MYYLNSRMLLQRERLIYTIGDRFLFKLPGWGTISEAFHVSPGT------------------VQSC 170
                          .:|...|.|..:....||..|...|.|..                  .|..
Human   276 --------------KLYQEKDAFQEEYYRTGTFPETPMVPPRRPWTLVNWLFWASLVLYPFFQFL 326

  Fly   171 VSILRDGNLLAI----------SPG-----GVYEAQFGDHY 196
            ||::|.|:.|.:          |.|     ||.|...|..|
Human   327 VSMIRSGSSLTLASFILVFFVASVGVRWMIGVTEIDKGSAY 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34348NP_001096954.1 PlsC 47..271 CDD:223282 33/171 (19%)
LPLAT_MGAT-like 90..298 CDD:153249 29/140 (21%)
AGPAT4NP_064518.1 PLN02380 20..345 CDD:178006 26/147 (18%)
LPLAT_LCLAT1-like 62..256 CDD:153252 7/38 (18%)
HXXXXD motif. /evidence=ECO:0000250|UniProtKB:Q9D517 96..101
Acyltransf_C 243..314 CDD:292694 16/92 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.