DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34348 and AGPAT3

DIOPT Version :9

Sequence 1:NP_001096954.1 Gene:CG34348 / 32072 FlyBaseID:FBgn0085377 Length:323 Species:Drosophila melanogaster
Sequence 2:XP_011527964.1 Gene:AGPAT3 / 56894 HGNCID:326 Length:463 Species:Homo sapiens


Alignment Length:361 Identity:67/361 - (18%)
Similarity:115/361 - (31%) Gaps:127/361 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LHSLLSSYIDLDYSLWLYRFL-TPLIVTFLLPLVFV----ALIYISFLVLFIYKLHRQVIMRAVQ 70
            :|.||||      ::.|..|| |..::..|:..|||    .:.::....|.::.:.:|:      
Human    80 VHPLLSS------AMGLLAFLKTQFVLHLLVGFVFVVSGLVINFVQLCTLALWPVSKQL------ 132

  Fly    71 GDRNFWRVGRKIVAAIWDAHARIYHGY--------------EVIGLENVPQEGPALIVYYHGAIP 121
                :.|:..::..::|.....:...:              |..|.|:      |:|:..|. ..
Human   133 ----YRRLNCRLAYSLWSQLVMLLEWWSCTECTLFTDQATVERFGKEH------AVIILNHN-FE 186

  Fly   122 IDMY----------YLNSRMLLQRERLIYTIGDRFLFKLPGWG-------TISEAFHVSPGTVQS 169
            ||..          .|.|..:|.::.|:|.       .|.||.       .....:.....||..
Human   187 IDFLCGWTMCERFGVLGSSKVLAKKELLYV-------PLIGWTWYFLEIVFCKRKWEEDRDTVVE 244

  Fly   170 CVSILRDGNLLAISPGGVYEAQFGDHYYELLW-------------RNRVGFAKVAIEAKAPIIPC 221
            .:..|.|                   |.|.:|             ::||.. :||.....|::..
Human   245 GLRRLSD-------------------YPEYMWFLLYCEGTRFTETKHRVSM-EVAAAKGLPVLKY 289

  Fly   222 FTQNLREGF-RQVGIFRTFFMRLY--------NKVRIPVYPIYG----------GFPVKFRTYLG 267
            ......:|| ..|...|.....:|        ||....:..:||          .||:       
Human   290 HLLPRTKGFTTAVKCLRGTVAAVYDVTLNFRGNKNPSLLGILYGKKYEADMCVRRFPL------- 347

  Fly   268 KPIPYDENLTPQDLQ--IKVATAIEDLINQHQRLPG 301
            :.||.||....|.|.  .:...|::::.||....||
Human   348 EDIPLDEKEAAQWLHKLYQEKDALQEIYNQKGMFPG 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34348NP_001096954.1 PlsC 47..271 CDD:223282 43/286 (15%)
LPLAT_MGAT-like 90..298 CDD:153249 48/272 (18%)
AGPAT3XP_011527964.1 PLN02380 104..412 CDD:178006 57/331 (17%)
LPLAT_LCLAT1-like 149..343 CDD:153252 37/227 (16%)
Acyltransf_C 330..401 CDD:292694 15/61 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.