DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34348 and agpat9l

DIOPT Version :10

Sequence 1:NP_001096954.1 Gene:CG34348 / 32072 FlyBaseID:FBgn0085377 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001092920.1 Gene:agpat9l / 567414 ZFINID:ZDB-GENE-060531-19 Length:443 Species:Danio rerio


Alignment Length:73 Identity:16/73 - (21%)
Similarity:31/73 - (42%) Gaps:16/73 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 YTIGDRFLFKLPGWGTISEAFHVSPGT-------------VQSCVSILRDGNLLAIS-PGGVYEA 190
            |:|....|..:..|..:...:::.|.|             |:|  :|.:.|.|:.:: .||:..|
Zfish   356 YSIMSYLLRMMTSWAIVCNVWYLPPMTHEEGEDAVQFANRVKS--TIAQQGGLVDLAWDGGLKRA 418

  Fly   191 QFGDHYYE 198
            :..|.:.|
Zfish   419 KVKDSFKE 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34348NP_001096954.1 LPLAT_MGAT-like 90..298 CDD:153249 16/73 (22%)
agpat9lNP_001092920.1 LPLAT_LPCAT1-like 208..417 CDD:153253 13/62 (21%)
HXXXXD motif 238..243
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.