DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG34348 and lpcat1

DIOPT Version :9

Sequence 1:	NP_001096954.1	Gene:	CG34348 / 32072	FlyBaseID:	FBgn0085377	Length:	323	Species:	Drosophila melanogaster
Sequence 2:	NP_001037806.2	Gene:	lpcat1 / 555969	ZFINID:	ZDB-GENE-060503-915	Length:	517	Species:	Danio rerio

Alignment Length:	137	Identity:	32/137 - (23%)
Similarity:	56/137 - (40%)	Gaps:	32/137 - (23%)

- Green bases have known domain annotations that are detailed below.

  Fly    35 IVTFLLPLVFVALIYISFLVL------FIYKLHRQVIMRAVQGDRNFWR-----VGRKIVAAIWD 88
            |....:.|..|.|::.:|::|      |:..:.|.  ..||: ..::||     ..:.|:.|:|.
Zfish    41 IAVMTVTLFPVRLLFAAFMMLLAWPFAFVATVGRS--ENAVE-PLSWWRWLVDLALKAIMRAMWF 102

  Fly    89 AHARIYHGYEVIGLENVPQEGPALIV----YYHGAIPIDMYYLNSRMLLQRERLIYTIGDRFLFK 149
            :..  :|...|.|...:|.|.|.|.:    .|..|||:.|...:..|..:.:            .
Zfish   103 SGG--FHWVRVKGRPALPSEAPILTMAPHSSYFDAIPVTMTMASIVMKAESK------------D 153

  Fly   150 LPGWGTI 156
            :|.|||:
Zfish   154 IPVWGTL 160

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG34348	NP_001096954.1	PlsC	47..271	CDD:223282	29/125 (23%)
CG34348	NP_001096954.1	LPLAT_MGAT-like	90..298	CDD:153249	17/71 (24%)
lpcat1	NP_001037806.2	PlsC	52..>236	CDD:223282	29/126 (23%)
		LPLAT_LPCAT1-like	97..308	CDD:153253	19/78 (24%)
		HXXXXD motif. /evidence=ECO:0000250\|UniProtKB:Q3TFD2	129..134		1/4 (25%)
		EF-hand_7	413..472	CDD:290234
		EF-hand_8	424..475	CDD:290545
		Di-lysine motif. /evidence=ECO:0000250\|UniProtKB:Q3TFD2	514..517
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0204
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900