powered by:
Protein Alignment CG34348 and LPCAT2
DIOPT Version :9
Sequence 1: | NP_001096954.1 |
Gene: | CG34348 / 32072 |
FlyBaseID: | FBgn0085377 |
Length: | 323 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_060309.2 |
Gene: | LPCAT2 / 54947 |
HGNCID: | 26032 |
Length: | 544 |
Species: | Homo sapiens |
Alignment Length: | 73 |
Identity: | 12/73 - (16%) |
Similarity: | 29/73 - (39%) |
Gaps: | 17/73 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 228 EGFRQVGIFRTFFMRLYNKVRIPVYPIYGGFPVKFRTYLGKPIPYDENLTPQDLQIKVATAIEDL 292
:|:..:.:....|.:|:.||.:...|: .:|.||. ::..:..|..:.:|
Human 262 QGYTFIQLCMLTFCQLFTKVEVEFMPV--------------QVPNDEE---KNDPVLFANKVRNL 309
Fly 293 INQHQRLP 300
:.:...:|
Human 310 MAEALGIP 317
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0204 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.