DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34348 and LPCAT2

DIOPT Version :9

Sequence 1:NP_001096954.1 Gene:CG34348 / 32072 FlyBaseID:FBgn0085377 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_060309.2 Gene:LPCAT2 / 54947 HGNCID:26032 Length:544 Species:Homo sapiens


Alignment Length:73 Identity:12/73 - (16%)
Similarity:29/73 - (39%) Gaps:17/73 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 EGFRQVGIFRTFFMRLYNKVRIPVYPIYGGFPVKFRTYLGKPIPYDENLTPQDLQIKVATAIEDL 292
            :|:..:.:....|.:|:.||.:...|:              .:|.||.   ::..:..|..:.:|
Human   262 QGYTFIQLCMLTFCQLFTKVEVEFMPV--------------QVPNDEE---KNDPVLFANKVRNL 309

  Fly   293 INQHQRLP 300
            :.:...:|
Human   310 MAEALGIP 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34348NP_001096954.1 PlsC 47..271 CDD:223282 6/42 (14%)
LPLAT_MGAT-like 90..298 CDD:153249 11/69 (16%)
LPCAT2NP_060309.2 LPLAT_LPCAT1-like 116..327 CDD:153253 12/73 (16%)
HXXXXD motif. /evidence=ECO:0000250|UniProtKB:Q3TFD2 146..151
EGTC motif 220..223
EFh_PEF 374..494 CDD:330173
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 518..544
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.