DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34348 and gpat3

DIOPT Version :9

Sequence 1:NP_001096954.1 Gene:CG34348 / 32072 FlyBaseID:FBgn0085377 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001002685.1 Gene:gpat3 / 436958 ZFINID:ZDB-GENE-040718-436 Length:449 Species:Danio rerio


Alignment Length:71 Identity:13/71 - (18%)
Similarity:27/71 - (38%) Gaps:12/71 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 YTIGDRFLFKLPGWGTISEAFHVSPGTVQS-----------CVSILRDGNLLAIS-PGGVYEAQF 192
            |.:....|..:..|..:...:::.|.|.|.           ..:|...|.|:.:| .||:..::.
Zfish   356 YNMVSYILRMMTSWAIVCNVWYLPPMTQQDGEDAVHFANRVKSAIAHQGGLVDLSWDGGLKRSKV 420

  Fly   193 GDHYYE 198
            .:.:.|
Zfish   421 KESFKE 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34348NP_001096954.1 PlsC 47..271 CDD:223282 13/71 (18%)
LPLAT_MGAT-like 90..298 CDD:153249 13/71 (18%)
gpat3NP_001002685.1 LPLAT_LPCAT1-like 208..417 CDD:153253 12/60 (20%)
HXXXXD motif. /evidence=ECO:0000250|UniProtKB:Q9D517 238..243
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.