powered by:
Protein Alignment CG34348 and gpat3
DIOPT Version :9
Sequence 1: | NP_001096954.1 |
Gene: | CG34348 / 32072 |
FlyBaseID: | FBgn0085377 |
Length: | 323 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001002685.1 |
Gene: | gpat3 / 436958 |
ZFINID: | ZDB-GENE-040718-436 |
Length: | 449 |
Species: | Danio rerio |
Alignment Length: | 71 |
Identity: | 13/71 - (18%) |
Similarity: | 27/71 - (38%) |
Gaps: | 12/71 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 140 YTIGDRFLFKLPGWGTISEAFHVSPGTVQS-----------CVSILRDGNLLAIS-PGGVYEAQF 192
|.:....|..:..|..:...:::.|.|.|. ..:|...|.|:.:| .||:..::.
Zfish 356 YNMVSYILRMMTSWAIVCNVWYLPPMTQQDGEDAVHFANRVKSAIAHQGGLVDLSWDGGLKRSKV 420
Fly 193 GDHYYE 198
.:.:.|
Zfish 421 KESFKE 426
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0204 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.