DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34348 and CG15450

DIOPT Version :9

Sequence 1:NP_001096954.1 Gene:CG34348 / 32072 FlyBaseID:FBgn0085377 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_608409.1 Gene:CG15450 / 33064 FlyBaseID:FBgn0031132 Length:407 Species:Drosophila melanogaster


Alignment Length:138 Identity:24/138 - (17%)
Similarity:51/138 - (36%) Gaps:46/138 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 DRNFWRVGR---KIVAAIWDAHARIYHGYEVIGLENVPQEGPALIVYYHGAI----PIDMY---- 125
            |.|:...|:   .|:..:..|.:|:.|.......|...:|...|::..|.::    |:.::    
  Fly   232 DANYSLTGQVHTGILGVLQRALSRVSHHMWFDRKELADREALGLVLRLHCSMKDRPPVLLFPEGT 296

  Fly   126 YLNSRMLLQRERLIYTIGDRFLFKLPGWGTISEAFHVSPGTVQSCVSILRDGNLLAISPGGVYEA 190
            .:|:..::|             || .|...:|:..|  |..::                   |:.
  Fly   297 CINNTAVMQ-------------FK-KGSFAVSDVVH--PVAIR-------------------YDR 326

  Fly   191 QFGDHYYE 198
            :||:.|::
  Fly   327 RFGEAYWD 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34348NP_001096954.1 PlsC 47..271 CDD:223282 24/138 (17%)
LPLAT_MGAT-like 90..298 CDD:153249 19/117 (16%)
CG15450NP_608409.1 LPLAT_LPCAT1-like 191..399 CDD:153253 24/138 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.