DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34348 and Agpat3

DIOPT Version :9

Sequence 1:NP_001096954.1 Gene:CG34348 / 32072 FlyBaseID:FBgn0085377 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001099848.1 Gene:Agpat3 / 294324 RGDID:1305787 Length:376 Species:Rattus norvegicus


Alignment Length:188 Identity:35/188 - (18%)
Similarity:54/188 - (28%) Gaps:74/188 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 LIYTIGDRF---------------------LFKLPGWGTISEAFHVSPGTVQSCVSIL------R 175
            |:|..|.||                     ...||.....:.|.....|||.:...:.      :
  Rat   172 LLYCEGTRFTETKHRVSMEVAASKGLPPLKYHLLPRTKGFTTAVQCLRGTVAAIYDVTLNFRGNK 236

  Fly   176 DGNLLAISPGGVYEAQF-----------GDHYYELLWRNRVGFAKVAIEAKAPIIPCFTQNLREG 229
            :.:||.|..|..|||..           .|......|.:::...|.|              |:|.
  Rat   237 NPSLLGILYGKKYEADMCVRRFPLEDIPADETGAAQWLHKLYQEKDA--------------LQEM 287

  Fly   230 FRQVGIF--------------------RTFFMRLYNKVRIPVYPIYGGFPVKFRTYLG 267
            ::|.|:|                    .||.:.......:.|:.  .|.|:...|:||
  Rat   288 YKQSGVFPGEQIKPARRPWTLLNFLCWATFLLSPLFSFVLGVFA--SGSPLLILTFLG 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34348NP_001096954.1 PlsC 47..271 CDD:223282 35/188 (19%)
LPLAT_MGAT-like 90..298 CDD:153249 35/188 (19%)
Agpat3NP_001099848.1 PLN02380 12..325 CDD:178006 29/166 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.