DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34348 and Gpat4

DIOPT Version :9

Sequence 1:NP_001096954.1 Gene:CG34348 / 32072 FlyBaseID:FBgn0085377 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001041314.1 Gene:Gpat4 / 290843 RGDID:1310520 Length:456 Species:Rattus norvegicus


Alignment Length:260 Identity:55/260 - (21%)
Similarity:87/260 - (33%) Gaps:117/260 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SLLS------SYIDLDYS-LW----LYRFLTPLIVTFLLPL-VFVALIYISFLVL---------- 55
            :|||      .||.|..: ||    |.|:      .||||| :.:|...||.||.          
  Rat   144 NLLSRTNYNFQYISLRLTILWGLGVLIRY------CFLLPLRIALAFTGISLLVAGTTVVGYLPS 202

  Fly    56 --FIYKLHRQVIMRAVQGDRNFWRVGRKIVAAIWDAHARIYHGYEVIGLENVPQEGPALIVYYHG 118
              |...|.:.|.:..       :|:..:.:.||...|.|          :|.|:.| .:.|..|.
  Rat   203 GRFKEFLSKHVHLMC-------YRICVRALTAIITYHNR----------KNRPRNG-GICVANHT 249

  Fly   119 AIPIDMYYLNSRMLLQRERLIYTIGDRFLFKLPG--WGTISEAFHVSPGTVQSCVSI------LR 175
            : |||:      ::|..:.....:|     ::.|  .|.|..|.      |::|..:      ::
  Rat   250 S-PIDV------IILASDGYYAMVG-----QVHGGLMGVIQRAM------VKACPHVWFERSEVK 296

  Fly   176 DGNLLA----------------ISPGGV---------------------------YEAQFGDHYY 197
            |.:|:|                |.|.|.                           |:.||||.::
  Rat   297 DRHLVAKRLTEHVQDKSKLPILIFPEGTCINNTSVMMFKKGSFEIGATVYPVAIKYDPQFGDAFW 361

  Fly   198  197
              Rat   362  361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34348NP_001096954.1 PlsC 47..271 CDD:223282 39/214 (18%)
LPLAT_MGAT-like 90..298 CDD:153249 29/159 (18%)
Gpat4NP_001041314.1 LPLAT_LPCAT1-like 218..427 CDD:153253 32/173 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.