Sequence 1: | NP_001096954.1 | Gene: | CG34348 / 32072 | FlyBaseID: | FBgn0085377 | Length: | 323 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001041314.1 | Gene: | Gpat4 / 290843 | RGDID: | 1310520 | Length: | 456 | Species: | Rattus norvegicus |
Alignment Length: | 260 | Identity: | 55/260 - (21%) |
---|---|---|---|
Similarity: | 87/260 - (33%) | Gaps: | 117/260 - (45%) |
- Green bases have known domain annotations that are detailed below.
Fly 13 SLLS------SYIDLDYS-LW----LYRFLTPLIVTFLLPL-VFVALIYISFLVL---------- 55
Fly 56 --FIYKLHRQVIMRAVQGDRNFWRVGRKIVAAIWDAHARIYHGYEVIGLENVPQEGPALIVYYHG 118
Fly 119 AIPIDMYYLNSRMLLQRERLIYTIGDRFLFKLPG--WGTISEAFHVSPGTVQSCVSI------LR 175
Fly 176 DGNLLA----------------ISPGGV---------------------------YEAQFGDHYY 197
Fly 198 197 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG34348 | NP_001096954.1 | PlsC | 47..271 | CDD:223282 | 39/214 (18%) |
LPLAT_MGAT-like | 90..298 | CDD:153249 | 29/159 (18%) | ||
Gpat4 | NP_001041314.1 | LPLAT_LPCAT1-like | 218..427 | CDD:153253 | 32/173 (18%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0204 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |