DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34348 and acl-12

DIOPT Version :9

Sequence 1:NP_001096954.1 Gene:CG34348 / 32072 FlyBaseID:FBgn0085377 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_509260.1 Gene:acl-12 / 181001 WormBaseID:WBGene00015295 Length:391 Species:Caenorhabditis elegans


Alignment Length:170 Identity:36/170 - (21%)
Similarity:67/170 - (39%) Gaps:31/170 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SYIDLDYSLWLYRFLTPLIVTFLLPLVFVALIYISFLVLFIYKLHRQVIMRAVQGDRNFWRVGRK 81
            |.:...|..::..::.|:.....:.|:|..:::.:  .||.|..|:...|               
 Worm    40 SLVGAAYFFFMTAWVVPVACVITVSLLFPLMLFST--PLFNYLEHKLCAM--------------- 87

  Fly    82 IVAAIWDAHARIYHGYEV----IGLENVPQEGPALIVYYHGAIP--IDMYYLNSRMLLQRERLIY 140
             |.|.|:| ..::.|..|    ..|....:|...|:..:.|.:.  :.|..||.:..: |.|.::
 Worm    88 -VNAHWNA-VSVFVGATVTEYGTNLAGYAEEKCLLLANHLGLLDHFVLMQSLNGKGSI-RSRWMW 149

  Fly   141 TIGDRFLFKLPG--WGTISEAFHVSPGTVQ--SCVSILRD 176
            .|.:.:.:...|  | |....|.|:.|..:  |.:|..||
 Worm   150 VIYNIWKYTPLGVMW-TSHGNFFVNGGVSKRDSVLSSFRD 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34348NP_001096954.1 PlsC 47..271 CDD:223282 31/140 (22%)
LPLAT_MGAT-like 90..298 CDD:153249 22/97 (23%)
acl-12NP_509260.1 LPLAT <156..290 CDD:302626 10/34 (29%)
Acyltransf_C 302..364 CDD:292694
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.