DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34348 and Aup1

DIOPT Version :9

Sequence 1:NP_001096954.1 Gene:CG34348 / 32072 FlyBaseID:FBgn0085377 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_031543.3 Gene:Aup1 / 11993 MGIID:107789 Length:410 Species:Mus musculus


Alignment Length:225 Identity:44/225 - (19%)
Similarity:79/225 - (35%) Gaps:57/225 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 LENVPQEGPALIVYYHGAIPIDMYYLNSRMLLQRERLIYTIGDRFLFKLPGWGTISEAFHVSPGT 166
            :|..|..||..:...| .:|.|.:.|.:.:|.....|...:...||           ..||   .
Mouse     1 MEPPPAPGPERLFDSH-RLPSDGFLLLALLLYAPVGLCLLVLRLFL-----------GLHV---F 50

  Fly   167 VQSCV---SILRD---GNLLAISPGGVYEAQ----FGDHYYELLWRNRV-----GFAKVAIEAKA 216
            :.||.   |:||.   ..:.|:.  |:...|    ..||...:|..|.|     ....:......
Mouse    51 LVSCALPDSVLRRFVVRTMCAVL--GLVARQEDSGLRDHRVRVLISNHVTPFDHNIVNLLTTCST 113

  Fly   217 PII------PCFTQNLREGFRQVGIFRTFFMRLYNKVRIPVYPIYGGFP-----------VKFRT 264
            |::      .|:::...|..|:|.:..: ..:.....|:|..|:. .||           ::|.:
Mouse   114 PLLNSPPSFVCWSRGFMEMDRRVELVES-LKKFCASTRLPPTPLL-LFPEEEATNGREGLLRFSS 176

  Fly   265 YLGKPIPYDENLTPQDLQIK---VATAIED 291
            :   |....:.:.|..||::   |:..:.|
Mouse   177 W---PFSIQDVVQPLTLQVQRPLVSVTVSD 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34348NP_001096954.1 PlsC 47..271 CDD:223282 39/200 (20%)
LPLAT_MGAT-like 90..298 CDD:153249 44/225 (20%)
Aup1NP_031543.3 LPLAT 66..264 CDD:418432 25/145 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 258..295
CUE_AUP1 296..340 CDD:270603
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 344..369
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.