Sequence 1: | NP_001096954.1 | Gene: | CG34348 / 32072 | FlyBaseID: | FBgn0085377 | Length: | 323 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011240406.1 | Gene: | Gpat4 / 102247 | MGIID: | 2142716 | Length: | 462 | Species: | Mus musculus |
Alignment Length: | 253 | Identity: | 55/253 - (21%) |
---|---|---|---|
Similarity: | 89/253 - (35%) | Gaps: | 97/253 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 13 SLLS------SYIDLDYS-LW------LYRFLTPLIVTFL---LPLVFVALIYISFLVLFIYK-- 59
Fly 60 LHRQVIMRAVQGDRNFWRVGRKIVAAIWDAHARIYHGYEVIGLENVPQEGPALIVYYHGAIPIDM 124
Fly 125 YYLNS--------------RMLLQR-----------------------ERLIYTIGDRFLFKLPG 152
Fly 153 WGTISEAFHVSP-GTV--QSCVSILRDGNL--------LAISPGGV--YEAQFGDHYY 197 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG34348 | NP_001096954.1 | PlsC | 47..271 | CDD:223282 | 40/203 (20%) |
LPLAT_MGAT-like | 90..298 | CDD:153249 | 33/158 (21%) | ||
Gpat4 | XP_011240406.1 | LPLAT_LPCAT1-like | 218..433 | CDD:153253 | 36/172 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0204 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |