DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34348 and Gpat4

DIOPT Version :9

Sequence 1:NP_001096954.1 Gene:CG34348 / 32072 FlyBaseID:FBgn0085377 Length:323 Species:Drosophila melanogaster
Sequence 2:XP_011240406.1 Gene:Gpat4 / 102247 MGIID:2142716 Length:462 Species:Mus musculus


Alignment Length:253 Identity:55/253 - (21%)
Similarity:89/253 - (35%) Gaps:97/253 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SLLS------SYIDLDYS-LW------LYRFLTPLIVTFL---LPLVFVALIYISFLVLFIYK-- 59
            :|||      .||.|..: ||      .|.||.||.:...   :.|:.|....:.:|....:|  
Mouse   144 NLLSRTNYNFQYISLRLTILWGLGVLIRYCFLLPLRIALAFTGIGLLVVGTTMVGYLPNGRFKEF 208

  Fly    60 LHRQVIMRAVQGDRNFWRVGRKIVAAIWDAHARIYHGYEVIGLENVPQEGPALIVYYHGAIPIDM 124
            |.:.|.:..       :|:..:.:.||...|.|          :|.|:.| .:.|..|.: |||:
Mouse   209 LSKHVHLMC-------YRICVRALTAIITYHNR----------KNRPRNG-GICVANHTS-PIDV 254

  Fly   125 YYLNS--------------RMLLQR-----------------------ERLIYTIGDRFLFKLPG 152
            ..|.|              ..::||                       :||...:.|:  .||| 
Mouse   255 IILASDGYYAMVGQVHGGLMGVIQRAMVKACPHVWFERSEVKDRHLVAKRLTEHVQDK--SKLP- 316

  Fly   153 WGTISEAFHVSP-GTV--QSCVSILRDGNL--------LAISPGGV--YEAQFGDHYY 197
                   ..:.| ||.  .:.|.:.:.|:.        :||.|..:  |:.||||.::
Mouse   317 -------ILIFPEGTCINNTSVMMFKKGSFEIGATVYPVAIKPPLLVQYDPQFGDAFW 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34348NP_001096954.1 PlsC 47..271 CDD:223282 40/203 (20%)
LPLAT_MGAT-like 90..298 CDD:153249 33/158 (21%)
Gpat4XP_011240406.1 LPLAT_LPCAT1-like 218..433 CDD:153253 36/172 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.