DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gapvd1 and ANKRD27

DIOPT Version :10

Sequence 1:NP_572704.1 Gene:Gapvd1 / 32070 FlyBaseID:FBgn0030286 Length:1712 Species:Drosophila melanogaster
Sequence 2:NP_115515.2 Gene:ANKRD27 / 84079 HGNCID:25310 Length:1050 Species:Homo sapiens


Alignment Length:240 Identity:58/240 - (24%)
Similarity:107/240 - (44%) Gaps:39/240 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly  1489 VRMYLAWSRQQEKLEQFQAEFAQLRASDERVELTEE-------FVESLLQELRSS---ADLQDEW 1543
            ||.:|  .|..|:.::..|.|.:.....||..|...       :.:.|.|.||.|   ...:.|.
Human   141 VREFL--GRHSERFDRNIASFHRTFRECERKSLRHHIDSANALYTKCLQQLLRDSHLKMLAKQEA 203

  Fly  1544 QVDAARVAIERMLLEQMYEQVMFPNEDADVSRDEVLSAHIGKLQRFVHPAHPALCIAQEYLGEAP 1608
            |::..:.|:|..:..::|..:.......:.|.|    |...|:.|.:..      :.|:.:|..|
Human   204 QMNLMKQAVEIYVHHEIYNLIFKYVGTMEASED----AAFNKITRSLQD------LQQKDIGVKP 258

  Fly  1609 -WTF----AQQQLCHMAAYKTPREKLQCIINCISSIMSLLRMS-SGRV----PAADDLLPVLIYV 1663
             ::|    |:::|..:....:|::||.    |:..::.|:..| |.||    ..|||||.||:|:
Human   259 EFSFNIPRAKRELAQLNKCTSPQQKLV----CLRKVVQLITQSPSQRVNLETMCADDLLSVLLYL 319

  Fly  1664 VIMANPPYLLSTVEYISCFLGKKLEGEDE--FYWTLFGSVVKFIK 1706
            ::....|..::.:.||..|....| .:||  :..|.|.:.:::|:
Human   320 LVKTEIPNWMANLSYIKNFRFSSL-AKDELGYCLTSFEAAIEYIR 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gapvd1NP_572704.1 RasGAP_RAP6 90..460 CDD:213331
MSCRAMM_ClfA <546..910 CDD:468110
YhaN 1412..>1540 CDD:443752 15/60 (25%)
VPS9 1609..1709 CDD:460489 30/109 (28%)
ANKRD27NP_115515.2 Sufficient for GEF activity towards RAB21. /evidence=ECO:0000269|PubMed:16525121 1..372 58/240 (24%)
VPS9 264..363 CDD:460489 28/103 (27%)
Sufficient for interaction with VPS29. /evidence=ECO:0000269|PubMed:24856514 396..460
ANKRD27_zf1 429..468 CDD:439265
Interaction with RAB32. /evidence=ECO:0000250|UniProtKB:Q3UMR0 451..730
Interaction with RAB38. /evidence=ECO:0000250|UniProtKB:Q3UMR0, ECO:0000269|PubMed:18477474 451..600
ANKYR <459..616 CDD:440430
ANK repeat 462..493 CDD:293786
ANK repeat 495..526 CDD:293786
ANK repeat 564..595 CDD:293786
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 625..665
Required for interaction with VAMP7. /evidence=ECO:0000250|UniProtKB:Q3UMR0, ECO:0000269|PubMed:19745841, ECO:0000269|PubMed:23104059 658..707
ANKYR 673..932 CDD:440430
ANK repeat 673..741 CDD:293786
Sufficient for interaction with VPS29. /evidence=ECO:0000269|PubMed:24856514 692..746
ANK repeat 743..774 CDD:293786
ANK 8 743..772
ANK 9 776..805
ANK repeat 780..807 CDD:293786
ANK repeat 809..840 CDD:293786
ANK 10 809..838
ANK repeat 842..873 CDD:293786
ANK 11 842..871
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 987..1050
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.