DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gapvd1 and VPS9B

DIOPT Version :9

Sequence 1:NP_572704.1 Gene:Gapvd1 / 32070 FlyBaseID:FBgn0030286 Length:1712 Species:Drosophila melanogaster
Sequence 2:NP_196494.2 Gene:VPS9B / 830791 AraportID:AT5G09320 Length:437 Species:Arabidopsis thaliana


Alignment Length:195 Identity:62/195 - (31%)
Similarity:96/195 - (49%) Gaps:14/195 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly  1526 VESLLQELRSSADLQDEW------QVDAARVAIERMLLEQMYEQVMFPNEDADVSRDEVLSAHIG 1584
            |:....::.|:......|      ::|.|...:|:.::.:::.:| |.:...||..||.|...|.
plant    47 VQDFFYKMESAFRAHPLWSGCSDDELDNAGDGLEKYVMTKLFPRV-FASNTEDVISDEKLFQKIS 110

  Fly  1585 KLQRFVHPAHPALCIAQEYLGEAPWTFAQQQLCHMAAYKTPREKLQCIINCISSIMSLLR----M 1645
            .:|:|:.|.:  |.|...:..:..|..||::|..:..|..||:||.||:.|...|.:||.    .
plant   111 LVQQFISPEN--LDIQPTFQNQTSWLLAQKELQKINMYNAPRDKLMCILRCCKVINNLLLNASIA 173

  Fly  1646 SSGRVPAADDLLPVLIYVVIMANPPYLLSTVEYISCFLGK-KLEGEDEFYWTLFGSVVKFIKTMD 1709
            |:...|.||..|||||||.|.||||...|.:.||..:..: ||.||..:.:|...|...||..:|
plant   174 SNQNEPGADQFLPVLIYVTIKANPPQFHSNLLYIQRYRRQSKLVGEAGYLFTNILSAESFISNID 238

  Fly  1710  1709
            plant   239  238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gapvd1NP_572704.1 RasGAP_RAP6 90..460 CDD:213331
VPS9 1609..1709 CDD:280383 42/104 (40%)
VPS9BNP_196494.2 DUF5601 24..88 CDD:407982 6/40 (15%)
VPS9 133..238 CDD:366977 42/104 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2319
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D944088at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23101
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.