DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gapvd1 and rabgef1l

DIOPT Version :9

Sequence 1:NP_572704.1 Gene:Gapvd1 / 32070 FlyBaseID:FBgn0030286 Length:1712 Species:Drosophila melanogaster
Sequence 2:NP_957235.1 Gene:rabgef1l / 393915 ZFINID:ZDB-GENE-040426-813 Length:470 Species:Danio rerio


Alignment Length:230 Identity:63/230 - (27%)
Similarity:113/230 - (49%) Gaps:27/230 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly  1502 LEQFQAE----FAQLRASDERV------------ELTEEFVESLLQELRSSADLQDEWQVDAARV 1550
            |:.||..    |.|..|..|.:            :..::|.:|:.:.|:::.....| .|:....
Zfish   139 LKPFQRPGYDIFKQCHAFAENIAHKKVVGCEDLSDSVQDFYQSMSEYLQTNFKGSPE-VVETVME 202

  Fly  1551 AIERMLLEQMYEQVMFPNEDADVSRDEVLSAHIGKLQRFVHPAHPA-LCI-AQEYLGEAPWTF-- 1611
            .:||.::.::|||:..|:...|..:|..:...|    |.:|....| ||: ..|.:.:...:.  
Zfish   203 EVERYVMGRLYEQLFCPDHTDDEKKDLTVQKRI----RALHWVSIAMLCVPLDEQIPKVSDSVER 263

  Fly  1612 AQQQLCHMAAYKTPREKLQCIINCISSIMSLLRMSSGRVPAADDLLPVLIYVVIMANPPYLLSTV 1676
            |:..|.::.:.|.|:|||.|:..|...|::.::.|.....:|||.||.|:|:::.||||.|.|.:
Zfish   264 AKTDLINLDSKKVPKEKLACVTRCSKHILTAIQGSKKAAASADDFLPALVYIILKANPPRLHSNI 328

  Fly  1677 EYIS--CFLGKKLEGEDEFYWTLFGSVVKFIKTMD 1709
            :||:  |...:.:.|||.:|:|.....|.||:.:|
Zfish   329 QYITRYCNPSRLMSGEDGYYFTNLCCAVSFIEKLD 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gapvd1NP_572704.1 RasGAP_RAP6 90..460 CDD:213331
VPS9 1609..1709 CDD:280383 35/103 (34%)
rabgef1lNP_957235.1 zf-A20 17..40 CDD:280010
VPS9 261..363 CDD:280383 35/101 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2319
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D944088at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.