DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gapvd1 and Rabgef1

DIOPT Version :9

Sequence 1:NP_572704.1 Gene:Gapvd1 / 32070 FlyBaseID:FBgn0030286 Length:1712 Species:Drosophila melanogaster
Sequence 2:XP_038945515.1 Gene:Rabgef1 / 360797 RGDID:1307295 Length:516 Species:Rattus norvegicus


Alignment Length:200 Identity:58/200 - (28%)
Similarity:103/200 - (51%) Gaps:11/200 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly  1516 DERVELTEEFVESLLQELRSSADLQDEWQVDAARVAIERMLLEQMYEQVMFPNEDADVSRDEVLS 1580
            :|:.|.|::|.:::.:.|::...:..| :|:.....||:.::.::|:.|..|....|..:|..:.
  Rat   201 EEQSECTQDFYQNVAERLQTRGKVPPE-KVEKMMDQIEKHIMTRLYKFVFCPETTDDEKKDLAIQ 264

  Fly  1581 AHIGKLQRFVHPAHP-ALCI-AQEYLGEAP--WTFAQQQLCHMAAYKTPREKLQCIINCISSIMS 1641
            ..|    |.:|...| .||: ..|.:.|..  ...|...:..|.:.:.||:||.||..|...|.:
  Rat   265 KRI----RALHWVTPQMLCVPVNEEIPEVSDMVVKAITDIIEMDSKRVPRDKLACITRCSKHIFN 325

  Fly  1642 LLRMSSGRVPAADDLLPVLIYVVIMANPPYLLSTVEYIS--CFLGKKLEGEDEFYWTLFGSVVKF 1704
            .::::.....:|||.||.|||:|:..|||.|.|.::||:  |...:.:.|||.:|:|.....|.|
  Rat   326 AIKITKNEPASADDFLPTLIYIVLKGNPPRLQSNIQYITRFCNPSRLMTGEDGYYFTNLCCAVAF 390

  Fly  1705 IKTMD 1709
            |:.:|
  Rat   391 IEKLD 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gapvd1NP_572704.1 RasGAP_RAP6 90..460 CDD:213331
VPS9 1609..1709 CDD:280383 35/101 (35%)
Rabgef1XP_038945515.1 zf-A20 41..63 CDD:396357
DUF5601 183..245 CDD:407982 9/44 (20%)
VPS9 295..395 CDD:366977 35/99 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2319
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D944088at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.