powered by:
Protein Alignment Gapvd1 and Y39A1A.24
DIOPT Version :9
Sequence 1: | NP_572704.1 |
Gene: | Gapvd1 / 32070 |
FlyBaseID: | FBgn0030286 |
Length: | 1712 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001379032.1 |
Gene: | Y39A1A.24 / 3564902 |
WormBaseID: | WBGene00012660 |
Length: | 126 |
Species: | Caenorhabditis elegans |
Alignment Length: | 70 |
Identity: | 19/70 - (27%) |
Similarity: | 33/70 - (47%) |
Gaps: | 5/70 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 929 VLGGESSFQQQYKCSGADSSGRKTT--PLMGT--SCMRRQTSAESSISN-QSLNLEEPPPPMGKH 988
||...|.|::|...:...:|.|.:| |::.| :..:|.:.|.:.:.. :|:.....|....||
Worm 44 VLKIASIFKKQAAGNTVSASKRGSTQSPVIRTAEASTQRASPAIAQVEKFESVRQPREPRSRSKH 108
Fly 989 HHHHR 993
|..||
Worm 109 HAKHR 113
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Gapvd1 | NP_572704.1 |
RasGAP_RAP6 |
90..460 |
CDD:213331 |
|
VPS9 |
1609..1709 |
CDD:280383 |
|
Y39A1A.24 | NP_001379032.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG2319 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.