DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gapvd1 and Y39A1A.24

DIOPT Version :9

Sequence 1:NP_572704.1 Gene:Gapvd1 / 32070 FlyBaseID:FBgn0030286 Length:1712 Species:Drosophila melanogaster
Sequence 2:NP_001379032.1 Gene:Y39A1A.24 / 3564902 WormBaseID:WBGene00012660 Length:126 Species:Caenorhabditis elegans


Alignment Length:70 Identity:19/70 - (27%)
Similarity:33/70 - (47%) Gaps:5/70 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   929 VLGGESSFQQQYKCSGADSSGRKTT--PLMGT--SCMRRQTSAESSISN-QSLNLEEPPPPMGKH 988
            ||...|.|::|...:...:|.|.:|  |::.|  :..:|.:.|.:.:.. :|:.....|....||
 Worm    44 VLKIASIFKKQAAGNTVSASKRGSTQSPVIRTAEASTQRASPAIAQVEKFESVRQPREPRSRSKH 108

  Fly   989 HHHHR 993
            |..||
 Worm   109 HAKHR 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gapvd1NP_572704.1 RasGAP_RAP6 90..460 CDD:213331
VPS9 1609..1709 CDD:280383
Y39A1A.24NP_001379032.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2319
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.