DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gapvd1 and Vps9d1

DIOPT Version :9

Sequence 1:NP_572704.1 Gene:Gapvd1 / 32070 FlyBaseID:FBgn0030286 Length:1712 Species:Drosophila melanogaster
Sequence 2:XP_006255829.1 Gene:Vps9d1 / 307923 RGDID:1565149 Length:648 Species:Rattus norvegicus


Alignment Length:263 Identity:58/263 - (22%)
Similarity:97/263 - (36%) Gaps:77/263 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly  1500 EKLEQFQAEFAQLRASDERVELTEEFVESLLQELRSSA-DLQDEWQVDAARVAIERML------- 1556
            |.||||.|.........:|        |.||:.|:|:. |:.:         ||:|:|       
  Rat   402 EDLEQFLAMSEPQTPGAKR--------EPLLECLKSTVKDIHN---------AIDRLLSLTLLAF 449

  Fly  1557 ---------------LEQMYEQVMFP-----------NEDADVSRD-----EVLSAHIGKLQRFV 1590
                           :|:.:...::|           ..:|.|||.     ..|...:|      
  Rat   450 ESLNTATCKDRCLACIEEPFFSPLWPLLLALYRSVHRTREAAVSRSMELYRNALPTALG------ 508

  Fly  1591 HPAHPALCIAQEYLGEAPWTFAQQQLCHMAAYKTPREKLQCIINCISSI---------MSLLRMS 1646
            .|.....|:.:......|:..|.|:|..:.....|::||:||:..:..|         ....|..
  Rat   509 IPTKLLPCVPEAQASTYPYCTAAQELGLLVLESCPQKKLECIVRTLRVICICAEDYCRAQEARPE 573

  Fly  1647 SGRVP-----AADDLLPVLIYVVIMANPPYLLSTVEYISCFLGK-KLEGEDEFYWTLFGSVVKFI 1705
            .|..|     .||||||:|.:||:.:..|.|:|....:..|..: .|.||:.:..|...|.:.::
  Rat   574 GGSQPPAAAIGADDLLPILSFVVLRSGLPQLVSECAALEEFTHEGYLIGEEGYCLTSLQSALSYV 638

  Fly  1706 KTM 1708
            :.:
  Rat   639 ELL 641

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gapvd1NP_572704.1 RasGAP_RAP6 90..460 CDD:213331
VPS9 1609..1709 CDD:280383 30/115 (26%)
Vps9d1XP_006255829.1 VPS9 527..642 CDD:280383 30/115 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2319
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.