DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gapvd1 and RABGEF1

DIOPT Version :10

Sequence 1:NP_572704.1 Gene:Gapvd1 / 32070 FlyBaseID:FBgn0030286 Length:1712 Species:Drosophila melanogaster
Sequence 2:NP_001354670.1 Gene:RABGEF1 / 27342 HGNCID:17676 Length:530 Species:Homo sapiens


Alignment Length:163 Identity:52/163 - (31%)
Similarity:84/163 - (51%) Gaps:8/163 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly  1552 IERMLLEQMYEQVMFPNEDADVSRDEVLSAHIGKLQRFVHPAHPALCI-AQEYLGEAP--WTFAQ 1613
            ||:.::.::|:.|..|....|..:|..:...|..| |:|.|  ..||: ..|.:.|..  ...|.
Human   250 IEKYIMTRLYKYVFCPETTDDEKKDLAIQKRIRAL-RWVTP--QMLCVPVNEDIPEVSDMVVKAI 311

  Fly  1614 QQLCHMAAYKTPREKLQCIINCISSIMSLLRMSSGRVPAADDLLPVLIYVVIMANPPYLLSTVEY 1678
            ..:..|.:.:.||:||.||..|...|.:.::::.....:|||.||.|||:|:..|||.|.|.::|
Human   312 TDIIEMDSKRVPRDKLACITKCSKHIFNAIKITKNEPASADDFLPTLIYIVLKGNPPRLQSNIQY 376

  Fly  1679 IS--CFLGKKLEGEDEFYWTLFGSVVKFIKTMD 1709
            |:  |...:.:.|||.:|:|.....|.||:.:|
Human   377 ITRFCNPSRLMTGEDGYYFTNLCCAVAFIEKLD 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gapvd1NP_572704.1 RasGAP_RAP6 90..460 CDD:213331
MSCRAMM_ClfA <546..910 CDD:468110
YhaN 1412..>1540 CDD:443752
VPS9 1609..1709 CDD:460489 35/101 (35%)
RABGEF1NP_001354670.1 zf-A20 17..40 CDD:460313
DUF5601 158..259 CDD:465668 2/8 (25%)
VPS9 309..409 CDD:460489 35/99 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.