DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gapvd1 and vps902

DIOPT Version :9

Sequence 1:NP_572704.1 Gene:Gapvd1 / 32070 FlyBaseID:FBgn0030286 Length:1712 Species:Drosophila melanogaster
Sequence 2:NP_001342780.1 Gene:vps902 / 2540384 PomBaseID:SPBC29A10.11c Length:402 Species:Schizosaccharomyces pombe


Alignment Length:259 Identity:54/259 - (20%)
Similarity:98/259 - (37%) Gaps:58/259 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  1481 QRCLLQALVRMYLAWSRQ----QEKLEQFQAEFAQLRASDERVELTEEFVESLLQELRSSAD--- 1538
            |.|::|.:..:......|    :|..:.||..:..          |:||:.|.|....||.|   
pombe    35 QACVIQFISSLVSPVHPQLLSPEELAKAFQNFYKH----------TDEFIASTLIPQPSSKDQNV 89

  Fly  1539 --------------------LQDEWQVDAARVAIERMLLEQMYEQVMFPNEDADVSRDEVLSAHI 1583
                                .:|||...     ||.::.|.:|:::...:...|.::|::|...|
pombe    90 PLLFPEEIDAQKKARQHLLNQKDEWMDQ-----IEDIVCEYLYDRIFCLSTSTDAAKDDLLKKFI 149

  Fly  1584 GKLQR------FVHPAHPALCIAQEYLGEAPWTFAQQQLCHMAAYKTPREKLQCIINCISSIMSL 1642
            ...::      ...|....|......:.||.:...:|.        |||.|:...:...|||::.
pombe   150 ASEEKKELINCIPIPDDEKLTNRLHEVSEAFFALDEQH--------TPRSKINTFMTVNSSILNA 206

  Fly  1643 LRMSSGRVPAADDLLPVLIYVVIMANPPYLLSTVEYISCFLGKK-LEGEDEFYWTLFGSVVKFI 1705
            .::....: .||.||.:.||.::.....:|:|.:.::..|.... |.||..:..|.|.:.:.||
pombe   207 SQLPQEEL-NADSLLNLTIYCILCYPGFHLISHLNFVLRFRNADFLSGEQRYCLTTFEAALTFI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gapvd1NP_572704.1 RasGAP_RAP6 90..460 CDD:213331
VPS9 1609..1709 CDD:280383 24/98 (24%)
vps902NP_001342780.1 VPS9 173..274 CDD:308039 26/106 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2319
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23101
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.