DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gapvd1 and LOC100498468

DIOPT Version :9

Sequence 1:NP_572704.1 Gene:Gapvd1 / 32070 FlyBaseID:FBgn0030286 Length:1712 Species:Drosophila melanogaster
Sequence 2:XP_031747412.1 Gene:LOC100498468 / 100498468 -ID:- Length:477 Species:Xenopus tropicalis


Alignment Length:304 Identity:70/304 - (23%)
Similarity:128/304 - (42%) Gaps:55/304 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly  1455 HRQQLLLRSEQ-----LEQLEARLR-----------GEARSSQRCL----LQALVRMYLAWSRQQ 1499
            |...|.::||:     |.|.|...|           ..::||.|..    :.|..|.::.||..:
 Frog    86 HTGTLFMKSERENTSDLGQNENTARVVTINTDTMYAQHSQSSYRYFPTTDVTADPRCFIPWSSLE 150

  Fly  1500 EKLEQFQAEFAQLRASDERVELTEEFVESLLQELRSSADL---------QDEWQVDAARVA---- 1551
            ...::..::|.:.....|..:|..: ..:|:|.|:::.:|         ||.:.    |:|    
 Frog   151 SMAKRDFSDFLKALRRPEAQQLNAQ-CTNLIQRLQNAKNLTPNTMGEQIQDFYH----RIADQFP 210

  Fly  1552 -------------IERMLLEQMYEQVMFPNEDADVSRDEVLSAHIGKLQRFVHPAHPALCIAQEY 1603
                         ||::::.::|..|...:...|..:|.:|...|..| ::|.|....:.:.:..
 Frog   211 DHMTEERGYFLDNIEKLVMTRLYRSVFCLDGSTDEQKDLLLQRRIKSL-KWVTPKMLQVPLDETI 274

  Fly  1604 LGEAPWTF-AQQQLCHMAAYKTPREKLQCIINCISSIMSLLRMSSGRVPAADDLLPVLIYVVIMA 1667
            :....||. |...:..|.:.:.|::||.|:....:.:...:|.|......|||.|..|||:.:.|
 Frog   275 VEVKDWTLSAVTAMLEMDSRRAPQDKLTCVSRASNCLFKSIRASKKDPATADDFLSCLIYITLRA 339

  Fly  1668 NPPYLLSTVEYISCFLG--KKLEGEDEFYWTLFGSVVKFIKTMD 1709
            |||.|.|.:||::.|..  :...||..:.:|.....|.||:.:|
 Frog   340 NPPRLFSNLEYLTRFCNPVRLTTGEWGYCFTNLCCAVSFIENLD 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gapvd1NP_572704.1 RasGAP_RAP6 90..460 CDD:213331
VPS9 1609..1709 CDD:280383 32/102 (31%)
LOC100498468XP_031747412.1 zf-A20 46..67 CDD:396357
DUF5601 175..233 CDD:407982 10/62 (16%)
VPS9 283..383 CDD:366977 30/99 (30%)
Lebercilin 399..>462 CDD:406132
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D944088at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.