DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXA11 and btn

DIOPT Version :10

Sequence 1:NP_005514.1 Gene:HOXA11 / 3207 HGNCID:5101 Length:313 Species:Homo sapiens
Sequence 2:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster


Alignment Length:120 Identity:43/120 - (35%)
Similarity:70/120 - (58%) Gaps:4/120 - (3%)


- Green bases have known domain annotations that are detailed below.


Human   190 SSSDSGGGGGCRETAAAAEEKERRRRPESSSSPESSSGHTEDKAGGSSGQRTRKKRCPYTKYQIR 254
            |:|.|.......||....|..::..:.|:.:..|..|..::.:|..|:    ||:|..::|.|::
  Fly    39 SASSSYADYNKLETNWCNEANDQWLQNEAPTGQELPSQRSKLRAISSN----RKERTAFSKTQLK 99

Human   255 ELEREFFFSVYINKEKRLQLSRMLNLTDRQVKIWFQNRRMKEKKINRDRLQYYSA 309
            :||.||.:|.|:.:.:|.:::..|.||:||||:||||||||.|:|..:..|..||
  Fly   100 QLEAEFCYSNYLTRLRRYEIAVALELTERQVKVWFQNRRMKCKRIKLEEQQGSSA 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXA11NP_005514.1 DUF3528 25..153 CDD:432284
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 154..246 13/55 (24%)
Homeodomain 242..298 CDD:459649 27/55 (49%)
btnNP_732768.1 Homeodomain 87..143 CDD:459649 27/55 (49%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.