DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXA11 and zen2

DIOPT Version :10

Sequence 1:NP_005514.1 Gene:HOXA11 / 3207 HGNCID:5101 Length:313 Species:Homo sapiens
Sequence 2:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster


Alignment Length:62 Identity:30/62 - (48%)
Similarity:47/62 - (75%) Gaps:0/62 - (0%)


- Green bases have known domain annotations that are detailed below.


Human   237 SGQRTRKKRCPYTKYQIRELEREFFFSVYINKEKRLQLSRMLNLTDRQVKIWFQNRRMKEKK 298
            |.:::::.|..::..|:.||||||..:.|:.:.:|:::|:.|.||:|||||||||||||.||
  Fly    39 SSEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKK 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXA11NP_005514.1 DUF3528 25..153 CDD:432284
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 154..246 1/8 (13%)
Homeodomain 242..298 CDD:459649 27/55 (49%)
zen2NP_476794.1 Homeodomain 44..100 CDD:459649 27/55 (49%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.