DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(1)10Bb and AT4G21110

DIOPT Version :9

Sequence 1:NP_511117.1 Gene:l(1)10Bb / 32069 FlyBaseID:FBgn0001491 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_001329615.1 Gene:AT4G21110 / 827859 AraportID:AT4G21110 Length:145 Species:Arabidopsis thaliana


Alignment Length:143 Identity:96/143 - (67%)
Similarity:120/143 - (83%) Gaps:1/143 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPKVRRSRKPPPDGWELIEPTLEELEQKMREAETEPHEGKRITESLWPIFKIHHQKTRYIYDLFY 65
            ||||:.:|...|:|||||||||.||:.|||||||:.|:|||..|:||||||:.||::||:|||:|
plant     1 MPKVKTNRVKYPEGWELIEPTLRELDAKMREAETDSHDGKRKCETLWPIFKVSHQRSRYVYDLYY 65

  Fly    66 RRKAISRELYDYCLKEKIADGNLIAKWKKSGYENLCCLRCIQTRDTNFGTNCICRVPKCKLEEGR 130
            ||:.||:|||::||.:..||.:|||||||||||.||||||||.||.|:||.|:||||| .|.|.:
plant    66 RREEISKELYEFCLDQGYADRSLIAKWKKSGYERLCCLRCIQPRDHNYGTTCVCRVPK-HLREEK 129

  Fly   131 IVECVHCGCRGCS 143
            :||||||||:||:
plant   130 VVECVHCGCQGCA 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(1)10BbNP_511117.1 G10 1..143 CDD:395894 95/141 (67%)
AT4G21110NP_001329615.1 G10 1..143 CDD:395894 96/143 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 221 1.000 Domainoid score I715
eggNOG 1 0.900 - - E1_COG5132
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2906
Inparanoid 1 1.050 220 1.000 Inparanoid score I1205
OMA 1 1.010 - - QHG54565
OrthoDB 1 1.010 - - D1236198at2759
OrthoFinder 1 1.000 - - FOG0004600
OrthoInspector 1 1.000 - - oto4142
orthoMCL 1 0.900 - - OOG6_102341
Panther 1 1.100 - - LDO PTHR19411
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3217
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.