DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(1)10Bb and bud31

DIOPT Version :9

Sequence 1:NP_511117.1 Gene:l(1)10Bb / 32069 FlyBaseID:FBgn0001491 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_001016359.2 Gene:bud31 / 549113 XenbaseID:XB-GENE-961904 Length:144 Species:Xenopus tropicalis


Alignment Length:144 Identity:126/144 - (87%)
Similarity:135/144 - (93%) Gaps:0/144 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPKVRRSRKPPPDGWELIEPTLEELEQKMREAETEPHEGKRITESLWPIFKIHHQKTRYIYDLFY 65
            ||||:|||||||||||||||||:||:|||||||||||||||..|||||||:|||||||||:||||
 Frog     1 MPKVKRSRKPPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRIHHQKTRYIFDLFY 65

  Fly    66 RRKAISRELYDYCLKEKIADGNLIAKWKKSGYENLCCLRCIQTRDTNFGTNCICRVPKCKLEEGR 130
            :||||||||||||::|..||.||||||||.||||||||||||||||||||||||||||.|||.||
 Frog    66 KRKAISRELYDYCIREGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICRVPKTKLEVGR 130

  Fly   131 IVECVHCGCRGCSG 144
            |:||.|||||||||
 Frog   131 IIECTHCGCRGCSG 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(1)10BbNP_511117.1 G10 1..143 CDD:395894 123/141 (87%)
bud31NP_001016359.2 G10 1..143 CDD:366478 123/141 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 249 1.000 Domainoid score I2082
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2906
Inparanoid 1 1.050 249 1.000 Inparanoid score I3164
OMA 1 1.010 - - QHG54565
OrthoDB 1 1.010 - - D1236198at2759
OrthoFinder 1 1.000 - - FOG0004600
OrthoInspector 1 1.000 - - oto105506
Panther 1 1.100 - - LDO PTHR19411
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R272
SonicParanoid 1 1.000 - - X3217
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.