DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(1)10Bb and cwf14

DIOPT Version :9

Sequence 1:NP_511117.1 Gene:l(1)10Bb / 32069 FlyBaseID:FBgn0001491 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_595965.1 Gene:cwf14 / 2540434 PomBaseID:SPBC24C6.11 Length:146 Species:Schizosaccharomyces pombe


Alignment Length:144 Identity:87/144 - (60%)
Similarity:113/144 - (78%) Gaps:2/144 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPKVRRSR-KPPPDGWELIEPTLEELEQKMREAETEPHEGKRITESLWPIFKIHHQKTRYIYDLF 64
            ||::|.|| |.||||::.|||||.|.:.:||:.|....:|.: ||.|.|||::|||::||||||:
pombe     1 MPRLRTSRTKRPPDGFDEIEPTLIEFQDRMRQIENTMGKGTK-TEMLAPIFQLHHQRSRYIYDLY 64

  Fly    65 YRRKAISRELYDYCLKEKIADGNLIAKWKKSGYENLCCLRCIQTRDTNFGTNCICRVPKCKLEEG 129
            |:|:|||.|||::.||:..|||||||||||.|||.|||||||||.::.||:.|||||||.||::.
pombe    65 YKREAISTELYNWLLKQNYADGNLIAKWKKPGYEKLCCLRCIQTAESKFGSTCICRVPKSKLDKD 129

  Fly   130 RIVECVHCGCRGCS 143
            :.|.|.||||.||:
pombe   130 QRVRCTHCGCNGCA 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(1)10BbNP_511117.1 G10 1..143 CDD:395894 86/142 (61%)
cwf14NP_595965.1 BUD31 1..146 CDD:227461 87/144 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 191 1.000 Domainoid score I719
eggNOG 1 0.900 - - E1_COG5132
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2906
Inparanoid 1 1.050 191 1.000 Inparanoid score I1049
OMA 1 1.010 - - QHG54565
OrthoFinder 1 1.000 - - FOG0004600
OrthoInspector 1 1.000 - - oto102124
orthoMCL 1 0.900 - - OOG6_102341
Panther 1 1.100 - - LDO PTHR19411
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R272
SonicParanoid 1 1.000 - - X3217
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.