DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(1)10Bb and Bud31

DIOPT Version :9

Sequence 1:NP_511117.1 Gene:l(1)10Bb / 32069 FlyBaseID:FBgn0001491 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_001297699.1 Gene:Bud31 / 231889 MGIID:2141291 Length:144 Species:Mus musculus


Alignment Length:144 Identity:125/144 - (86%)
Similarity:134/144 - (93%) Gaps:0/144 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPKVRRSRKPPPDGWELIEPTLEELEQKMREAETEPHEGKRITESLWPIFKIHHQKTRYIYDLFY 65
            ||||:||||.||||||||||||:||:|||||||||||||||..|||||||:|||||||||:||||
Mouse     1 MPKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRIHHQKTRYIFDLFY 65

  Fly    66 RRKAISRELYDYCLKEKIADGNLIAKWKKSGYENLCCLRCIQTRDTNFGTNCICRVPKCKLEEGR 130
            :|||||||||:||:||..||.||||||||.||||||||||||||||||||||||||||.|||.||
Mouse    66 KRKAISRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICRVPKSKLEVGR 130

  Fly   131 IVECVHCGCRGCSG 144
            |:||.|||||||||
Mouse   131 IIECTHCGCRGCSG 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(1)10BbNP_511117.1 G10 1..143 CDD:395894 122/141 (87%)
Bud31NP_001297699.1 G10 1..143 CDD:395894 122/141 (87%)
Nuclear localization signal. /evidence=ECO:0000255 2..10 6/7 (86%)
Interaction with AR. /evidence=ECO:0000250|UniProtKB:P41223 59..67 6/7 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847013
Domainoid 1 1.000 279 1.000 Domainoid score I1687
eggNOG 1 0.900 - - E1_COG5132
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 281 1.000 Inparanoid score I2876
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54565
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004600
OrthoInspector 1 1.000 - - oto95327
orthoMCL 1 0.900 - - OOG6_102341
Panther 1 1.100 - - LDO PTHR19411
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R272
SonicParanoid 1 1.000 - - X3217
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.