DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(1)10Bb and bud-31

DIOPT Version :9

Sequence 1:NP_511117.1 Gene:l(1)10Bb / 32069 FlyBaseID:FBgn0001491 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_001366676.1 Gene:bud-31 / 176368 WormBaseID:WBGene00007400 Length:147 Species:Caenorhabditis elegans


Alignment Length:142 Identity:100/142 - (70%)
Similarity:121/142 - (85%) Gaps:0/142 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KVRRSRKPPPDGWELIEPTLEELEQKMREAETEPHEGKRITESLWPIFKIHHQKTRYIYDLFYRR 67
            |:||.||.||:||:|||||||:.|.||||||||||||||.||..||||:||||::||:||::|::
 Worm     6 KLRRVRKSPPEGWDLIEPTLEQFEAKMREAETEPHEGKRKTEINWPIFRIHHQRSRYVYDMYYKK 70

  Fly    68 KAISRELYDYCLKEKIADGNLIAKWKKSGYENLCCLRCIQTRDTNFGTNCICRVPKCKLEEGRIV 132
            ..||||||::||..|.||..|||||||.|||||||::|:.|||:||||.|||||||.||:..|::
 Worm    71 AEISRELYEFCLTAKFADAALIAKWKKQGYENLCCVKCVNTRDSNFGTACICRVPKSKLDAERVI 135

  Fly   133 ECVHCGCRGCSG 144
            |||||||.||||
 Worm   136 ECVHCGCHGCSG 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(1)10BbNP_511117.1 G10 1..143 CDD:395894 97/139 (70%)
bud-31NP_001366676.1 G10 6..146 CDD:395894 97/139 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164623
Domainoid 1 1.000 236 1.000 Domainoid score I1311
eggNOG 1 0.900 - - E1_COG5132
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2906
Inparanoid 1 1.050 238 1.000 Inparanoid score I2122
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54565
OrthoDB 1 1.010 - - D1236198at2759
OrthoFinder 1 1.000 - - FOG0004600
OrthoInspector 1 1.000 - - oto20516
orthoMCL 1 0.900 - - OOG6_102341
Panther 1 1.100 - - LDO PTHR19411
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R272
SonicParanoid 1 1.000 - - X3217
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1615.840

Return to query results.
Submit another query.