DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir10a and Ir7d

DIOPT Version :9

Sequence 1:NP_001096949.1 Gene:Ir10a / 32067 FlyBaseID:FBgn0083979 Length:609 Species:Drosophila melanogaster
Sequence 2:NP_001138175.1 Gene:Ir7d / 7354416 FlyBaseID:FBgn0259190 Length:594 Species:Drosophila melanogaster


Alignment Length:427 Identity:84/427 - (19%)
Similarity:146/427 - (34%) Gaps:132/427 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 RDG-VWIYDPFKRRDSAFGRLVRYYGSETLDKLLFRDMAGYPLRIQMFR-SVYTRPEFDKETGLL 214
            :|| :|  |.|.||                    .:::.|.||.:.::. ..|.|..: |.:..:
  Fly   192 KDGDLW--DVFPRR--------------------LKNLHGCPLSVIVWDIPPYMRINW-KSSDPM 233

  Fly   215 TRVTGVDFLVAQMLRERLNFTMLL--QQPEKKYFGERSANGSYNGAIGSIIKDGLDICLTGFFVK 277
            ..:.|:|.|:.:::..::|||:.|  .:|.....|....||::.||.                  
  Fly   234 DGLDGLDGLLLRIVARKMNFTLKLIPNEPNGLIGGSSFMNGTFTGAY------------------ 280

  Fly   278 DYLVQQYMDFTV--AVYDDELCIYVPKASRIPQSILPIFAV-----GYDIWLGFVLTAFACALIW 335
            ..|.::..:.|:  |....|...::...|  |.|.:....|     ||.|: ..:|..|. ...|
  Fly   281 KMLRERRANITIGCAACTPERSTFLEATS--PYSQMSYIIVLQARGGYSIY-EVMLFPFE-KYTW 341

  Fly   336 LTLRVINLKLRIVSLGNQHIVGQALGI---MVDTWVVWVRLNLSHLPASYAERMFIGTLCLVSVI 397
            |.|..|        ||...|||....:   ::..|::|:.:    :.|||...:|       :.|
  Fly   342 LLLSTI--------LGLHWIVGSRWRMPSPILAGWMLWIFV----IRASYEASVF-------NFI 387

  Fly   398 FGAIFESSLATV---------YIHPLYYKDINTMQELDESGLKVVYKYSSMADDLFFSETSPLFA 453
            ..:..:.|..|:         :|             .|.:..::..|..|.......|...|:  
  Fly   388 QNSPVKPSPRTLDQALSGGFRFI-------------TDHASYRMTLKIPSFQGKTLISAGQPV-- 437

  Fly   454 SLNKKLSWNRDLRADVIDEVARFRNKAGVSRYTSLILESSHFTLLRK----IWVVPECPKYYTIS 514
                          ||.|.:.:...|.|.  :||....:.|....||    :.::.|......:.
  Fly   438 --------------DVFDALLKAPWKTGA--FTSRAFLADHLVRHRKHRNQLVILAEKIVDNMLC 486

  Fly   515 YVMPRDS--PWEDAVNALLLRFLNAGL------IVKW 543
            ...|..|  .||  :|.||....:.|:      |:.|
  Fly   487 MYFPHGSYFAWE--INKLLFNMRSFGIFQHHSQILAW 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir10aNP_001096949.1 Periplasmic_Binding_Protein_Type_2 220..>294 CDD:304360 15/77 (19%)
TM_PBP1_branched-chain-AA_like 315..>411 CDD:294309 24/112 (21%)
Lig_chan 319..587 CDD:278489 48/249 (19%)
Ir7dNP_001138175.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.