DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir10a and Ir92a

DIOPT Version :9

Sequence 1:NP_001096949.1 Gene:Ir10a / 32067 FlyBaseID:FBgn0083979 Length:609 Species:Drosophila melanogaster
Sequence 2:NP_001097845.2 Gene:Ir92a / 42415 FlyBaseID:FBgn0038789 Length:678 Species:Drosophila melanogaster


Alignment Length:392 Identity:70/392 - (17%)
Similarity:145/392 - (36%) Gaps:87/392 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 NGSYNGAIGSIIKDGLDI---CLTGFFVKDYLVQQYMDFTVAVYDDELCIYVPKASRIPQSILPI 313
            |.|.:|.:|.|.:..:::   |:..::  |.:.:  ...|:|  ...:.|..|..:.:|.....|
  Fly   319 NESSDGMLGDIYEQRVEMAIGCIYNWY--DGITE--TSHTIA--RSSVTILGPAPAPLPSWRTNI 377

  Fly   314 FAVGYDIWLGFVLTAFACALIWLTLRVINLKLRIVSLGNQ---HIVGQALGIMVDTWVVWVRLNL 375
            .......||..:.|...|......::.::.:||.  .|.|   |...:....|:|.:.::::...
  Fly   378 MPFNNRAWLVLISTLVICGTFLYFMKYVSYRLRY--SGTQVKFHHSRKLEKSMLDIFALFIQQPS 440

  Fly   376 SHLPAS-YAERMFIGTLCLVSVIFGAIFESSLATVYIHPLYYKDINTMQELDESGLK-----VVY 434
            :.|... :|.|.|:.|:...::....|:...|.::...|.|...::|:::..:||.|     :::
  Fly   441 APLSFDRFAPRFFLATILCATITLENIYSGQLKSMLTFPFYSAPVDTIEKWAQSGWKWSAPSIIW 505

  Fly   435 KYSSMADDLFFSETSPLFASLNKKLSWNRDLRA---DVIDEVARFRNKA-GVSRYTS-------- 487
            .::..:.||   ||..:.|         |:...   ..:..|:...|.. |:.|.:|        
  Fly   506 VHTVQSSDL---ETEQILA---------RNFEVHDYSYLSNVSFMPNYGFGIERLSSGSLSVGDY 558

  Fly   488 ----------LILESSHFTLLRKI----WVVPECPKYYTISYVMPRDSPWEDAVNALLLRFLNAG 538
                      ::.:..:|...|.:    |:            :||.       :|..:......|
  Fly   559 VSTEALENRIVLHDDLYFDYTRAVSIRGWI------------LMPE-------LNKHIRTCQETG 604

  Fly   539 LIVKWIQDEKSWVD---IKMRSNILEADAESELVR----VLTIGDLQLAFYVVIGGNLLAFLGFL 596
            |...|   |..::|   .|.:..:|...|....|:    .|.:.::..|.:|:..|...|....:
  Fly   605 LYFHW---ELEFIDKYMDKKKQEVLMDLANGHKVKGAPQALDVRNIAGALFVLAFGVAFAGCALV 666

  Fly   597 AE 598
            ||
  Fly   667 AE 668

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir10aNP_001096949.1 Periplasmic_Binding_Protein_Type_2 220..>294 CDD:304360 9/44 (20%)
TM_PBP1_branched-chain-AA_like 315..>411 CDD:294309 18/99 (18%)
Lig_chan 319..587 CDD:278489 53/309 (17%)
Ir92aNP_001097845.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.