DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir10a and Ir68b

DIOPT Version :9

Sequence 1:NP_001096949.1 Gene:Ir10a / 32067 FlyBaseID:FBgn0083979 Length:609 Species:Drosophila melanogaster
Sequence 2:NP_648548.1 Gene:Ir68b / 39378 FlyBaseID:FBgn0036250 Length:635 Species:Drosophila melanogaster


Alignment Length:536 Identity:125/536 - (23%)
Similarity:210/536 - (39%) Gaps:112/536 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 LRL-EGSCRQLWTQHKVYNRFFLTRD-GVWIYDPFKRRDSAFGRLVRYYGSETLDKL-------- 183
            ||| .||    |.:..:|......|: |.:.:|||     |:|      |.:.:.:|        
  Fly   134 LRLFRGS----WAKKLLYGLAITGRENGTFDFDPF-----AWG------GLQVIQRLDGEVPYAR 183

  Fly   184 LFRDMAGYPLRIQMFRS-VYTRPEFDKETGLLTRVTGVDFLVAQMLRERLNFTMLLQQPE-KKYF 246
            ..:|:.|||||..||.. :...|....||.....|.||   .|:::.|.||.::....|| .:.:
  Fly   184 KVKDLRGYPLRFSMFTDPLMAMPRSPVETAGYQAVDGV---AARVVGEMLNASVTYVFPEDNESY 245

  Fly   247 GERSANGSYNGAIGSIIKDGLDICLTGFFVKDYL---VQQYMDFTVAVYDDELCIYVPKASRIPQ 308
            |....||:|.|.:..|:...........||.|.:   |:....:|    ...|.:.||.::..|:
  Fly   246 GRCLPNGNYTGVVSDIVGGHTHFAPNSRFVLDCIWPAVEVLYPYT----RRNLHLVVPASAIQPE 306

  Fly   309 SILPIFAVGYDIWLGFVLTAFACALI-WLTLRVINLKLRIVSLGNQHIVGQALGIMVDTWVVWVR 372
            .::.:......:|...::|.....|: |:..|   |:.||...|           ::.....|..
  Fly   307 YLIFVRVFRRTVWYLLLVTLLVVVLVFWVMQR---LQRRIPRRG-----------VIQFQATWYE 357

  Fly   373 L----NLSHL--PA----SYAE-RMFIGTLCLVSVIFGAIFESSLATVYIHPLYYKDINTMQELD 426
            :    ..:|:  ||    |::. |.|:....|.|.:...|:.:.|.:.::.|.|.:.::.:.:|.
  Fly   358 ILEMFGKTHVGEPAGRLSSFSSMRTFLMGWILFSYVLSTIYFAKLESGFVRPSYEEQVDRVDDLV 422

  Fly   427 ESGLKVVYKYSSMADDLFFSETSPLFASL-NKKLSWNRDLRADVIDEVARFRNKAGVSRYTSLIL 490
            ...:. :|..::|.|.:..:.|...:..| |:.......:.......|.|.|:     |..:.|:
  Fly   423 HLDVH-IYAVTTMYDAVRSALTEHQYGLLENRSRQLPLGIATSYYQPVVRRRD-----RRAAFIM 481

  Fly   491 ESSHFTLLRKIWVV-----PECPKYY---------TISYVMPRDSPWEDAVNALLLRFLNAGLIV 541
            ...|   .|....:     .|.|.|:         ..:|::||.||:...:.:|...||..|...
  Fly   482 RDFH---ARDFLAITYDSQAERPAYHIAREYLRSMICTYILPRGSPFLHRLESLYSGFLEHGFFE 543

  Fly   542 KWIQDEKSWVDIKMR-------SNILE-----ADAES---EL-VR----VLTIGDLQLAFYVVIG 586
            .|.|     :|:..|       ...||     .|.:|   || :|    |||:..||.|||:...
  Fly   544 HWRQ-----MDLITRVGASPDAEEFLEDLGDQTDTDSGSNELAIRNKKVVLTLDILQGAFYLWSV 603

  Fly   587 GNLLAFLGFLAEHFRW 602
            |..::.|||..||..|
  Fly   604 GIGISCLGFAVEHAHW 619

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir10aNP_001096949.1 Periplasmic_Binding_Protein_Type_2 220..>294 CDD:304360 18/77 (23%)
TM_PBP1_branched-chain-AA_like 315..>411 CDD:294309 20/107 (19%)
Lig_chan 319..587 CDD:278489 67/314 (21%)
Ir68bNP_648548.1 Lig_chan 333..607 CDD:278489 65/301 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D284164at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.