DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir10a and Ir56b

DIOPT Version :9

Sequence 1:NP_001096949.1 Gene:Ir10a / 32067 FlyBaseID:FBgn0083979 Length:609 Species:Drosophila melanogaster
Sequence 2:NP_611430.1 Gene:Ir56b / 37250 FlyBaseID:FBgn0034456 Length:408 Species:Drosophila melanogaster


Alignment Length:401 Identity:80/401 - (19%)
Similarity:154/401 - (38%) Gaps:84/401 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 AQMLRERLNFTMLLQQPEKKYFGERSANGSYNGAIGSIIKDGLDICLTGFFVKDYLVQQYMDFTV 289
            |::...:|....|...|:|....:...:|.||            :.|.|..::......:.:.|.
  Fly    48 AEVYHYQLFLDSLESLPKKSVVEQDIISGKYN------------LSLHGVIIRPEETSDFFNATQ 100

  Fly   290 AVYDDEL---CIYVPKASRIPQSILPIFAVGYDIWLGFVLTAFACALIWLTLRVINLKLRIVSLG 351
            ..|..||   |:.||.|..:|:.:..::.:|..||....|..|..||:   ||.::.:    ..|
  Fly   101 HSYPLELMTNCVMVPLAPELPKWMYMVWPLGKYIWTCLFLGTFYVALL---LRYVHWR----EPG 158

  Fly   352 N-----QHIVGQALGIMVDTWVVWVRLNLSHLPASYAERMFIGTLCLVSVIFGAIFESSLATVYI 411
            |     ...|..|:.:::.:..:.:.:.|.|  ||....:|...|.:...|......|.:....:
  Fly   159 NATRSYTRNVLHAMALLMFSANMNMSVKLKH--ASIRVIIFYTLLYIFGFILTNYHLSHMTAFDM 221

  Fly   412 HPLYYKDINTMQELDESGLKVVYKYSSMADDLFFSETSPLFASLNKKLSWNRDLRADVIDEVARF 476
            .|::.:.|:|..:|..|.|::|. :.|:.::|   ...|::.:|                     
  Fly   222 KPVFLRPIDTWSDLIHSRLRIVI-HDSLLEEL---RWLPVYQAL--------------------- 261

  Fly   477 RNKAGVSR-YTSLILESS--HFTLLRKIWVVPECPKYYTISYV----------MPRDSPWEDAVN 528
              .|..|| |..::.:.:  .|...:|:.:.|    |:.:|.|          |..::.:.|::|
  Fly   262 --LASPSRSYAYVVTQDAWLFFNRQQKVLIQP----YFHLSKVCFGGLFNALPMASNASFADSLN 320

  Fly   529 ALLLRFLNAGLIVKWIQDEKSWVDIKMR----SNILEADAESELVRVLTIGDLQLAFYVVIGGNL 589
            ..:|....|||   |    ..|.::..|    :...:...::..|..|.:.....|:.|:..|..
  Fly   321 KFILNVWQAGL---W----NYWEELAFRYAEQAGYAKVFLDTYPVEPLNLEFFTTAWIVLSAGIP 378

  Fly   590 LAFLGFLAEHF 600
            ::.|.|..|.|
  Fly   379 ISSLAFCLELF 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir10aNP_001096949.1 Periplasmic_Binding_Protein_Type_2 220..>294 CDD:304360 12/68 (18%)
TM_PBP1_branched-chain-AA_like 315..>411 CDD:294309 21/100 (21%)
Lig_chan 319..587 CDD:278489 55/289 (19%)
Ir56bNP_611430.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.