DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir10a and Ir52d

DIOPT Version :9

Sequence 1:NP_001096949.1 Gene:Ir10a / 32067 FlyBaseID:FBgn0083979 Length:609 Species:Drosophila melanogaster
Sequence 2:NP_611042.2 Gene:Ir52d / 36716 FlyBaseID:FBgn0050464 Length:594 Species:Drosophila melanogaster


Alignment Length:530 Identity:100/530 - (18%)
Similarity:179/530 - (33%) Gaps:151/530 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 FYILADQDKDLSADEQLRLEG---SCRQLWTQHKVYNRFFLTRDGVWIYDPFKRRDSAFGRLVRY 174
            ||...||......:......|   :||..  |.:.|.:.:|: :|..||                
  Fly   129 FYSKKDQYNIAMVNNNFHQVGIIYACRLF--QERNYEKVYLS-EGNPIY---------------- 174

  Fly   175 YGSETLDKLLFRDMAGYPLRIQMFRSV-----YTRPEFDKETGLLTRVTGVDFLVAQMLR---ER 231
                 :|:  ||:|.|..|:...|..:     |..|:..:|..:        ..||.:|.   |:
  Fly   175 -----VDQ--FRNMQGALLKSITFNLIPGSMAYRDPKTGQEKHI--------GYVANLLNNFVEK 224

  Fly   232 LNFTMLLQQPEKKYFGERSANGSYNGAIGSIIKDGLDIC----LTGFFVKDYLVQQYMDFTVAVY 292
            :|.|:.:|....|...:.|.......|...::..|:...    :|.|   |.:...|:..:.   
  Fly   225 VNATLDMQVKLHKAGKKTSFYNITKWASEDLVDIGMSYAAYFEMTNF---DTISYPYLMTST--- 283

  Fly   293 DDELCIYVPKASRIPQSILPIFAVGYDIWLGF-------VLTAFACAL----------IWLTLRV 340
                |..||....:|.|         :|::|.       ||.|..|..          .|.:|.:
  Fly   284 ----CFMVPLPDMMPNS---------EIYMGIVDPPVLVVLIAIFCIFSVMLNYIKQRSWRSLSL 335

  Fly   341 INLKLRIVSLGNQHIVGQALGIMVDTWVVWVRLNLSHLPASYAERMFIGTL--CLVSVIFGAIFE 403
            :|:.|..:.|         .|.:...:         ..|.....::.:.::  |..|||...::.
  Fly   336 VNVLLNDICL---------RGFLAQPF---------PFPRQSNRKLKLISMLVCFFSVITTTMYT 382

  Fly   404 SSLATVYIHPLYYKDINTMQELDESGLKV-VYKYS---------SMADDLFFSETSPLFASLNKK 458
            |.|.:....|.....:.:..:|:.|..|: :.:|.         ||...:.|.|:|        :
  Fly   383 SYLQSFMWGPPIDPKMCSFADLENSRYKLAIRRYDIEMLRPFNVSMDHVVVFDESS--------Q 439

  Fly   459 LSWNRDLRADVIDEVARFRNKAGVSRYTSLILESSHFTLLRKIWVVPECPKYYT----------I 513
            |.:.||...|..             .|....|..|.|...:|::..|..  ||:          .
  Fly   440 LEYLRDSFDDNY-------------MYPMSALSWSAFKEQQKLFAFPLF--YYSEKLCLKPISFF 489

  Fly   514 SYVMPRDSPWEDAVNALLLRFLNAGLIVKWIQDEKSWVD-IKMRSNILEADAESELVRVLTIGDL 577
            |:.:.|..|:.|.....:|:....||...||  ::|:.| ::::...:...:...|...:.:.||
  Fly   490 SFPIRRHLPYRDLFEEHMLQQNEFGLSTYWI--DRSFSDMVRLKLATMNDFSPPRLEDYIEVSDL 552

  Fly   578 QLAFYVVIGG 587
            ...|.:...|
  Fly   553 SWVFGMYFTG 562

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir10aNP_001096949.1 Periplasmic_Binding_Protein_Type_2 220..>294 CDD:304360 15/80 (19%)
TM_PBP1_branched-chain-AA_like 315..>411 CDD:294309 19/114 (17%)
Lig_chan 319..587 CDD:278489 56/307 (18%)
Ir52dNP_611042.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.